PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Home  TFext  BLAST  Prediction  Download  Help  About  Links  PlantRegMap
(e.g., LFY)
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EPS71642.1
Organism
Genlisea aurea
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea
Family ZF-HD
Protein Properties Length: 57aa    MW: 6201.09 Da    PI: 8.1307
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EPS71642.1genomeLSMUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer91.95.9e-29355356
  ZF-HD_dimer  3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRre 56
                  v+Y+eC+kNhAa +G  avDGC+Efmp+ geeg+ aal+CaAC CHRnFH++ 
   EPS71642.1  3 VVTYEECRKNHAAGIGKFAVDGCCEFMPA-GEEGSGAALRCAACSCHRNFHKKV 55
                 699*************************9.999*******************97 PP
Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257744.0E-15454IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047702.7E-27455IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015662.5E-25554IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152324.115655IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Sequence ? help Back to Top
Protein Sequence    Length: 57 aa     Download sequence    Send to blast
ERVVTYEECR KNHAAGIGKF AVDGCCEFMP AGEEGSGAAL RCAACSCHRN FHKKVVR
Functional Description ? help Back to Top
Source Description
UniProtEssential protein. Putative transcription factor.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010246148.14e-24PREDICTED: mini zinc finger protein 2-like
SwissprotQ9SB619e-20ZHD2_ARATH; Zinc-finger homeodomain protein 2
TrEMBLS8EG593e-33S8EG59_9LAMI; Uncharacterized protein (Fragment)
STRINGMigut.L01769.1.p1e-32(Erythranthe guttata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA11052486
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24660.14e-22homeobox protein 22
Publications ? help Back to Top
  1. Leushkin EV, et al.
    The miniature genome of a carnivorous plant Genlisea aurea contains a low number of genes and short non-coding sequences.
    BMC Genomics, 2013. 14: p. 476
    [PMID:23855885]
  2. Bueso E,Serrano R,Pallás V,Sánchez-Navarro JA
    Seed tolerance to deterioration in arabidopsis is affected by virus infection.
    Plant Physiol. Biochem., 2017. 116: p. 1-8
    [PMID:28477474]