PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

EPS71772.1

Organism

Genlisea aurea

Taxonomic ID

192259

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea

Family

WRKY

Protein Properties

Length: 80aa MW: 9164.31 Da PI: 9.4995

Description

WRKY family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
EPS71772.1	genome	LSMU	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	WRKY	108.7	2.8e-34	19	77	1	59
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 ldDgy+WrKYGqK v+g+++prsYY+Cts gC v+k+ver+++dp++v++ Yeg+Hnhe EPS71772.1 19 LDDGYRWRKYGQKLVRGNPNPRSYYKCTSIGCAVRKHVERARNDPNAVITSYEGKHNHE 77 59********************************************************8 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:2.20.25.80	7.8E-37	5	79	IPR003657	WRKY domain
SuperFamily	SSF118290	2.22E-30	11	79	IPR003657	WRKY domain
PROSITE profile	PS50811	37.057	14	79	IPR003657	WRKY domain
SMART	SM00774	2.1E-36	19	78	IPR003657	WRKY domain
Pfam	PF03106	1.9E-26	20	77	IPR003657	WRKY domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 80 aa Download sequence Send to blast
VEDGKPRVIV QTVSEVDILD DGYRWRKYGQ KLVRGNPNPR SYYKCTSIGC AVRKHVERAR 60 NDPNAVITSY EGKHNHEVPP

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1wj2_A	2e-38	10	79	8	77	Probable WRKY transcription factor 4
2lex_A	2e-38	10	79	8	77	Probable WRKY transcription factor 4
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor involved in starch synthesis (PubMed:12953112). Acts as a transcriptional activator in sugar signaling (PubMed:16167901). Interacts specifically with the SURE and W-box elements, but not with the SP8a element (PubMed:12953112). {ECO:0000269\|PubMed:12953112, ECO:0000269\|PubMed:16167901}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Up-regulated by sugar. {ECO:0000269\|PubMed:12953112}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_019460531.1	2e-41	PREDICTED: probable WRKY transcription factor 20 isoform X1
Refseq	XP_019460532.1	1e-41	PREDICTED: probable WRKY transcription factor 20 isoform X2
Refseq	XP_028758455.1	5e-42	probable WRKY transcription factor 20
Swissprot	Q6VWJ6	2e-41	WRK46_HORVU; WRKY transcription factor SUSIBA2
TrEMBL	S8EGG5	3e-52	S8EGG5_9LAMI; Uncharacterized protein (Fragment)
STRING	XP_010683807.1	5e-40	(Beta vulgaris)
STRING	evm.model.supercontig_12.196	4e-40	(Carica papaya)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA2124	24	62

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G26640.1	2e-42	WRKY family protein

Publications ? help Back to Top
Leushkin EV, et al. The miniature genome of a carnivorous plant Genlisea aurea contains a low number of genes and short non-coding sequences. BMC Genomics, 2013. 14: p. 476 [PMID:23855885]