PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

EPS72532.1

Organism

Genlisea aurea

Taxonomic ID

192259

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea

Family

Dof

Protein Properties

Length: 134aa MW: 14942 Da PI: 9.636

Description

Dof family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
EPS72532.1	genome	LSMU	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	zf-Dof	115.7	1.9e-36	28	81	6	59
zf-Dof 6 lkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknk 59 ++cprC s++tkfCy+nny+++qPr++C++C+ryWt+GGalrnvP+G+grrk k EPS72532.1 28 IPCPRCRSADTKFCYFNNYNVNQPRHYCRGCQRYWTAGGALRNVPIGAGRRKVK 81 78**************************************************87 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
ProDom	PD007478	2.0E-24	13	81	IPR003851	Zinc finger, Dof-type
PROSITE profile	PS50884	27.689	28	82	IPR003851	Zinc finger, Dof-type
Pfam	PF02701	1.5E-30	29	81	IPR003851	Zinc finger, Dof-type
PROSITE pattern	PS01361	0	30	66	IPR003851	Zinc finger, Dof-type

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0010214	Biological Process	seed coat development
GO:0044212	Molecular Function	transcription regulatory region DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 134 aa Download sequence Send to blast
NATGIKLFGA VISESDRTAE KRREAIGIPC PRCRSADTKF CYFNNYNVNQ PRHYCRGCQR 60 YWTAGGALRN VPIGAGRRKV KPPGMVAAAE AGEFVDGCFF DPSSVGFVGV EDWEEKAAEM 120 GRFRDVFPAK RRRT

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence. Acts as a negative regulator in the phytochrome-mediated light responses. Controls phyB-mediated end-of-day response and the phyA-mediated anthocyanin accumulation. Not involved in direct flowering time regulation. {ECO:0000269\|PubMed:19619493}.

Binding Motif ? help Back to Top
Motif ID	Method	Source	Motif file
MP00166	DAP	Transfer from AT1G29160	Download

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By red or far-red light. Circadian-regulation. The transcript level rises progressively from dawn and decreases during the night. {ECO:0000269\|PubMed:19619493}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	Retrieve

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_022777308.1	2e-47	dof zinc finger protein DOF1.5-like isoform X1
Refseq	XP_022777309.1	2e-47	dof zinc finger protein DOF1.5-like isoform X2
Swissprot	P68350	3e-44	DOF15_ARATH; Dof zinc finger protein DOF1.5
TrEMBL	S8EIV7	1e-93	S8EIV7_9LAMI; Uncharacterized protein (Fragment)
STRING	VIT_10s0003g01260.t01	1e-46	(Vitis vinifera)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA7240	22	32

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G29160.1	1e-46	Dof family protein

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Leushkin EV, et al. The miniature genome of a carnivorous plant Genlisea aurea contains a low number of genes and short non-coding sequences. BMC Genomics, 2013. 14: p. 476 [PMID:23855885] Bueso E, et al. Arabidopsis COGWHEEL1 links light perception and gibberellins with seed tolerance to deterioration. Plant J., 2016. 87(6): p. 583-96 [PMID:27227784]