PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

EPS72669.1

Organism

Genlisea aurea

Taxonomic ID

192259

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea

Family

G2-like

Protein Properties

Length: 142aa MW: 15476.4 Da PI: 10.8892

Description

G2-like family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
EPS72669.1	genome	LSMU	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	G2-like	103.7	1.1e-32	18	71	2	55
G2-like 2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 pr+rWt+ LH+rFv+av+ LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+ EPS72669.1 18 PRMRWTSSLHARFVHAVDLLGGHERATPKSVLELMDVKDLTLAHVKSHLQMYRT 71 9****************************************************7 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF46689	4.66E-16	15	72	IPR009057	Homeodomain-like
Gene3D	G3DSA:1.10.10.60	4.0E-29	16	71	IPR009057	Homeodomain-like
TIGRFAMs	TIGR01557	2.5E-24	18	71	IPR006447	Myb domain, plants
Pfam	PF00249	3.5E-7	19	70	IPR001005	SANT/Myb domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0009887	Biological Process	organ morphogenesis
GO:0009944	Biological Process	polarity specification of adaxial/abaxial axis
GO:0009956	Biological Process	radial pattern formation
GO:0010051	Biological Process	xylem and phloem pattern formation
GO:0010158	Biological Process	abaxial cell fate specification
GO:0010229	Biological Process	inflorescence development
GO:0048481	Biological Process	plant ovule development
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 142 aa Download sequence Send to blast
MRSRFLPKIP AKRSMRAPRM RWTSSLHARF VHAVDLLGGH ERATPKSVLE LMDVKDLTLA 60 HVKSHLQMYR TVKTTDKPAA SSGHSDGSGE DDMSTVGSGG GLRQFIGSPP RDSDANFQSS 120 TPPTLWSNSS SGRDGWLQMN GG

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
6j4k_A	1e-18	19	73	4	58	Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B	1e-18	19	73	4	58	Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A	1e-18	19	73	4	58	Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C	1e-18	19	73	4	58	Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D	1e-18	19	73	4	58	Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F	1e-18	19	73	4	58	Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H	1e-18	19	73	4	58	Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J	1e-18	19	73	4	58	Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcriptional repressor that regulates lateral organ polarity. Promotes lateral organ abaxial identity by repressing the adaxial regulator ASYMMETRIC LEAVES2 (AS2) in abaxial cells. Required for abaxial identity in both leaves and carpels. Functions with KAN2 in the specification of polarity of the ovule outer integument. Regulates cambium activity by repressing the auxin efflux carrier PIN1. Plays a role in lateral root formation and development. {ECO:0000269\|PubMed:11395775, ECO:0000269\|PubMed:11525739, ECO:0000269\|PubMed:14561401, ECO:0000269\|PubMed:15286295, ECO:0000269\|PubMed:16623911, ECO:0000269\|PubMed:17307928, ECO:0000269\|PubMed:18849474, ECO:0000269\|PubMed:20179097}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Repressed by AS2 in adaxial tissue. {ECO:0000269\|PubMed:18849474}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_020551952.1	2e-70	transcription repressor KAN1 isoform X2
Swissprot	Q93WJ9	7e-53	KAN1_ARATH; Transcription repressor KAN1
TrEMBL	S8CYX3	7e-99	S8CYX3_9LAMI; Uncharacterized protein (Fragment)
STRING	XP_009772639.1	9e-69	(Nicotiana sylvestris)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA2468	23	55

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G16560.1	2e-49	G2-like family protein

Publications ? help Back to Top
Leushkin EV, et al. The miniature genome of a carnivorous plant Genlisea aurea contains a low number of genes and short non-coding sequences. BMC Genomics, 2013. 14: p. 476 [PMID:23855885] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Huang T,Kerstetter RA,Irish VF APUM23, a PUF family protein, functions in leaf development and organ polarity in Arabidopsis. J. Exp. Bot., 2014. 65(4): p. 1181-91 [PMID:24449383] Mach J Getting in Shape? Leaves work it out with KANADI1. Plant Cell, 2014. 26(1): p. 4 [PMID:24464293] Jun SE, et al. Comparative analysis of the conserved functions of Arabidopsis DRL1 and yeast KTI12. Mol. Cells, 2015. 38(3): p. 243-50 [PMID:25518926] Machida C,Nakagawa A,Kojima S,Takahashi H,Machida Y The complex of ASYMMETRIC LEAVES (AS) proteins plays a central role in antagonistic interactions of genes for leaf polarity specification in Arabidopsis. Wiley Interdiscip Rev Dev Biol, 2015 Nov-Dec. 4(6): p. 655-71 [PMID:26108442] Xie Y, et al. Meta-Analysis of Arabidopsis KANADI1 Direct Target Genes Identifies a Basic Growth-Promoting Module Acting Upstream of Hormonal Signaling Pathways. Plant Physiol., 2015. 169(2): p. 1240-53 [PMID:26246448] Alvarez JP,Furumizu C,Efroni I,Eshed Y,Bowman JL Active suppression of a leaf meristem orchestrates determinate leaf growth. Elife, 2017. [PMID:27710768] Singh A, et al. Phytohormonal crosstalk modulates the expression of miR166/165s, target Class III HD-ZIPs, and KANADI genes during root growth in Arabidopsis thaliana. Sci Rep, 2017. 7(1): p. 3408 [PMID:28611467] Caggiano MP, et al. Cell type boundaries organize plant development. Elife, 2018. [PMID:28895530] Ó'Maoiléidigh DS,Stewart D,Zheng B,Coupland G,Wellmer F Floral homeotic proteins modulate the genetic program for leaf development to suppress trichome formation in flowers. Development, 2018. [PMID:29361563]