PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

EPS72933.1

Organism

Genlisea aurea

Taxonomic ID

192259

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea

Family

NAC

Protein Properties

Length: 158aa MW: 18738.5 Da PI: 9.6279

Description

NAC family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
EPS72933.1	genome	LSMU	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NAM	163.8	6.1e-51	10	138	1	129
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk.kge 98 lppGfrF P+deelv++yL kk++++++ ++ e+d++++ePw Lp +k +++ewyfFs rd+kyatg r+nrat++gyWkatgkd++++++ + EPS72933.1 10 LPPGFRFYPSDEELVCHYLYKKISKEEVVR-GTLVEIDLHTCEPWMLPDVAKLNSNEWYFFSFRDRKYATGYRTNRATTTGYWKATGKDRPIVDTkTYG 107 79***********************777.78***********87778899*********************************975566 PP NAM 99 lvglkktLvfykgrapkgektdWvmheyrle 129 +vg++ktLvfy++rap+g kt+W+mhe+rle EPS72933.1 108 VVGMRKTLVFYRNRAPNGLKTSWIMHEFRLE 138 7*************************985 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF101941	1.57E-60	9	156	IPR003441	NAC domain
PROSITE profile	PS51005	57.28	10	156	IPR003441	NAC domain
Pfam	PF02365	3.8E-28	11	137	IPR003441	NAC domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 158 aa Download sequence Send to blast
MGLRDIGDTL PPGFRFYPSD EELVCHYLYK KISKEEVVRG TLVEIDLHTC EPWMLPDVAK 60 LNSNEWYFFS FRDRKYATGY RTNRATTTGY WKATGKDRPI VDTKTYGVVG MRKTLVFYRN 120 RAPNGLKTSW IMHEFRLENP HLPPKEDWVL CRVFYKSR

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1ut4_A	2e-47	9	157	16	166	NO APICAL MERISTEM PROTEIN
1ut4_B	2e-47	9	157	16	166	NO APICAL MERISTEM PROTEIN
1ut7_A	2e-47	9	157	16	166	NO APICAL MERISTEM PROTEIN
1ut7_B	2e-47	9	157	16	166	NO APICAL MERISTEM PROTEIN
4dul_A	2e-47	9	157	16	166	NAC domain-containing protein 19
4dul_B	2e-47	9	157	16	166	NAC domain-containing protein 19
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription activator. Involved in molecular mechanisms regulating shoot apical meristem (SAM) formation during embryogenesis and organ separation. Required for axillary meristem initiation and separation of the meristem from the main stem. May act as an inhibitor of cell division. {ECO:0000269\|PubMed:12837947, ECO:0000269\|PubMed:17122068}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By BRM, at the chromatin level, and conferring a very specific spatial expression pattern. {ECO:0000269\|PubMed:16854978}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_007050267.1	1e-103	PREDICTED: NAC domain-containing protein 21/22
Refseq	XP_012442853.1	1e-103	PREDICTED: protein CUP-SHAPED COTYLEDON 3-like
Swissprot	Q9S851	4e-59	NAC31_ARATH; Protein CUP-SHAPED COTYLEDON 3
TrEMBL	S8EAP0	1e-115	S8EAP0_9LAMI; Uncharacterized protein (Fragment)
STRING	Gorai.001G254300.1	1e-102	(Gossypium raimondii)
STRING	EOX94424	1e-103	(Theobroma cacao)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA1882	24	66

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G28530.1	2e-89	NAC domain containing protein 74

Publications ? help Back to Top
Leushkin EV, et al. The miniature genome of a carnivorous plant Genlisea aurea contains a low number of genes and short non-coding sequences. BMC Genomics, 2013. 14: p. 476 [PMID:23855885] Chen C, et al. Transcriptome profiling reveals roles of meristem regulators and polarity genes during fruit trichome development in cucumber (Cucumis sativus L.). J. Exp. Bot., 2014. 65(17): p. 4943-58 [PMID:24962999] Gonçalves B, et al. A conserved role for CUP-SHAPED COTYLEDON genes during ovule development. Plant J., 2015. 83(4): p. 732-42 [PMID:26119568] Balkunde R,Kitagawa M,Xu XM,Wang J,Jackson D SHOOT MERISTEMLESS trafficking controls axillary meristem formation, meristem size and organ boundaries in Arabidopsis. Plant J., 2017. 90(3): p. 435-446 [PMID:28161901] Espinosa-Ruiz A, et al. TOPLESS mediates brassinosteroid control of shoot boundaries and root meristem development in Arabidopsis thaliana. Development, 2017. 144(9): p. 1619-1628 [PMID:28320734] Koyama T,Sato F,Ohme-Takagi M Roles of miR319 and TCP Transcription Factors in Leaf Development. Plant Physiol., 2017. 175(2): p. 874-885 [PMID:28842549]