PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

EPS73373.1

Organism

Genlisea aurea

Taxonomic ID

192259

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea

Family

GRF

Protein Properties

Length: 140aa MW: 16525.1 Da PI: 10.0742

Description

GRF family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
EPS73373.1	genome	LSMU	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	WRC	75.5	5.7e-24	83	125	2	44
WRC 2 aepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkske 44 epgrC+RtDGKkWRCsr+v + +k+CErHlhrgr rsrk++e EPS73373.1 83 LEPGRCKRTDGKKWRCSRDVAPHQKYCERHLHRGRPRSRKHVE 125 69***************************************98 PP
2	QLQ	49.2	1.6e-17	23	57	2	36
QLQ 2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiq 36 +FT aQ+ +L Q+++yKy+a+++PvPpeLl +++ EPS73373.1 23 PFTFAQWKELQIQAMIYKYMASSVPVPPELLYPLS 57 8******************************9986 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00951	7.4E-9	22	58	IPR014978	Glutamine-Leucine-Glutamine, QLQ
PROSITE profile	PS51666	19.537	23	58	IPR014978	Glutamine-Leucine-Glutamine, QLQ
Pfam	PF08880	8.3E-13	23	56	IPR014978	Glutamine-Leucine-Glutamine, QLQ
PROSITE profile	PS51667	24.059	82	126	IPR014977	WRC domain
Pfam	PF08879	1.1E-19	84	125	IPR014977	WRC domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0010114	Biological Process	response to red light
GO:0010218	Biological Process	response to far red light
GO:0080167	Biological Process	response to karrikin
GO:0005634	Cellular Component	nucleus
GO:0005524	Molecular Function	ATP binding

Sequence ? help Back to Top
Protein Sequence Length: 140 aa Download sequence Send to blast
MNKQLFDDFC YQSSGSAAAV EFPFTFAQWK ELQIQAMIYK YMASSVPVPP ELLYPLSRTS 60 SSSPCKKIFL ASFCLLRMRN RDLEPGRCKR TDGKKWRCSR DVAPHQKYCE RHLHRGRPRS 120 RKHVEVYTHR LLKEDGYFLQ

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription activator that plays a role in the regulation of cell expansion in leaf and cotyledons tissues. Component of a network formed by miR396, the GRFs and their interacting factors (GIFs) acting in the regulation of meristem function, at least partially through the control of cell proliferation. {ECO:0000250}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: microRNA 396 (miR396a or miR396b) negatively regulates growth-regulating factors (GRF1-4 and GRF7-9). {ECO:0000269\|PubMed:15200956, ECO:0000269\|PubMed:19453503, ECO:0000269\|PubMed:20023165}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_015872909.1	7e-50	growth-regulating factor 4-like, partial
Refseq	XP_015872939.1	1e-49	growth-regulating factor 6-like, partial
Swissprot	Q9FJB8	3e-37	GRF7_ARATH; Growth-regulating factor 7
TrEMBL	S8EBU3	1e-101	S8EBU3_9LAMI; Uncharacterized protein (Fragment)
STRING	XP_009791786.1	1e-47	(Nicotiana sylvestris)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA7032	22	30

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G53660.1	1e-39	growth-regulating factor 7

Publications ? help Back to Top
Leushkin EV, et al. The miniature genome of a carnivorous plant Genlisea aurea contains a low number of genes and short non-coding sequences. BMC Genomics, 2013. 14: p. 476 [PMID:23855885] Cao Y,Han Y,Jin Q,Lin Y,Cai Y Comparative Genomic Analysis of the GRF Genes in Chinese Pear (Pyrus bretschneideri Rehd), Poplar (Populous), Grape (Vitis vinifera), Arabidopsis and Rice (Oryza sativa). Front Plant Sci, 2016. 7: p. 1750 [PMID:27933074]