![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | EPS73643.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea
|
||||||||
| Family | Dof | ||||||||
| Protein Properties | Length: 77aa MW: 8733.97 Da PI: 9.6925 | ||||||||
| Description | Dof family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | zf-Dof | 125 | 2.5e-39 | 2 | 61 | 3 | 62 |
zf-Dof 3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
+k+l+cprC s++tkfCyynny+++qPr+fCk C+ryWt GG++rnvPvG+grrk k+s
EPS73643.1 2 DKILPCPRCSSMDTKFCYYNNYNINQPRHFCKCCQRYWTSGGTMRNVPVGAGRRKTKNSA 61
7899****************************************************9876 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| ProDom | PD007478 | 2.0E-27 | 1 | 58 | IPR003851 | Zinc finger, Dof-type |
| Pfam | PF02701 | 2.6E-32 | 3 | 59 | IPR003851 | Zinc finger, Dof-type |
| PROSITE profile | PS50884 | 28.211 | 5 | 59 | IPR003851 | Zinc finger, Dof-type |
| PROSITE pattern | PS01361 | 0 | 7 | 43 | IPR003851 | Zinc finger, Dof-type |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 77 aa Download sequence Send to blast |
PDKILPCPRC SSMDTKFCYY NNYNINQPRH FCKCCQRYWT SGGTMRNVPV GAGRRKTKNS 60 ASNCGHITIS EALNATR |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence (By similarity). Regulates a photoperiodic flowering response. Transcriptional repressor of 'CONSTANS' expression. {ECO:0000250, ECO:0000269|PubMed:19619493}. | |||||
| Binding Motif ? help Back to Top | |||
|---|---|---|---|
| Motif ID | Method | Source | Motif file |
| MP00394 | DAP | Transfer from AT3G47500 | Download |
| |||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Circadian-regulation. Highly expressed at the beginning of the light period, then decreases, reaching a minimum between 16 and 29 hours after dawn before rising again at the end of the day. {ECO:0000269|PubMed:19619493}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | Retrieve | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_027123677.1 | 2e-44 | cyclic dof factor 3-like | ||||
| Swissprot | Q8LFV3 | 1e-41 | CDF3_ARATH; Cyclic dof factor 3 | ||||
| TrEMBL | S8ECH1 | 4e-51 | S8ECH1_9LAMI; Uncharacterized protein (Fragment) | ||||
| STRING | Solyc03g115940.2.1 | 6e-43 | (Solanum lycopersicum) | ||||
| STRING | XP_009619973.1 | 6e-43 | (Nicotiana tomentosiformis) | ||||
| STRING | PGSC0003DMT400050273 | 7e-43 | (Solanum tuberosum) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Asterids | OGEA7240 | 22 | 32 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G47500.1 | 4e-44 | cycling DOF factor 3 | ||||




