PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

EPS73643.1

Organism

Genlisea aurea

Taxonomic ID

192259

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea

Family

Dof

Protein Properties

Length: 77aa MW: 8733.97 Da PI: 9.6925

Description

Dof family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
EPS73643.1	genome	LSMU	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	zf-Dof	125	2.5e-39	2	61	3	62
zf-Dof 3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 +k+l+cprC s++tkfCyynny+++qPr+fCk C+ryWt GG++rnvPvG+grrk k+s EPS73643.1 2 DKILPCPRCSSMDTKFCYYNNYNINQPRHFCKCCQRYWTSGGTMRNVPVGAGRRKTKNSA 61 7899****************************************************9876 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
ProDom	PD007478	2.0E-27	1	58	IPR003851	Zinc finger, Dof-type
Pfam	PF02701	2.6E-32	3	59	IPR003851	Zinc finger, Dof-type
PROSITE profile	PS50884	28.211	5	59	IPR003851	Zinc finger, Dof-type
PROSITE pattern	PS01361	0	7	43	IPR003851	Zinc finger, Dof-type

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 77 aa Download sequence Send to blast
PDKILPCPRC SSMDTKFCYY NNYNINQPRH FCKCCQRYWT SGGTMRNVPV GAGRRKTKNS 60 ASNCGHITIS EALNATR

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence (By similarity). Regulates a photoperiodic flowering response. Transcriptional repressor of 'CONSTANS' expression. {ECO:0000250, ECO:0000269\|PubMed:19619493}.

Binding Motif ? help Back to Top
Motif ID	Method	Source	Motif file
MP00394	DAP	Transfer from AT3G47500	Download

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Circadian-regulation. Highly expressed at the beginning of the light period, then decreases, reaching a minimum between 16 and 29 hours after dawn before rising again at the end of the day. {ECO:0000269\|PubMed:19619493}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	Retrieve

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_027123677.1	2e-44	cyclic dof factor 3-like
Swissprot	Q8LFV3	1e-41	CDF3_ARATH; Cyclic dof factor 3
TrEMBL	S8ECH1	4e-51	S8ECH1_9LAMI; Uncharacterized protein (Fragment)
STRING	Solyc03g115940.2.1	6e-43	(Solanum lycopersicum)
STRING	XP_009619973.1	6e-43	(Nicotiana tomentosiformis)
STRING	PGSC0003DMT400050273	7e-43	(Solanum tuberosum)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA7240	22	32

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G47500.1	4e-44	cycling DOF factor 3

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Leushkin EV, et al. The miniature genome of a carnivorous plant Genlisea aurea contains a low number of genes and short non-coding sequences. BMC Genomics, 2013. 14: p. 476 [PMID:23855885] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Corrales AR, et al. Multifaceted role of cycling DOF factor 3 (CDF3) in the regulation of flowering time and abiotic stress responses in Arabidopsis. Plant Cell Environ., 2017. 40(5): p. 748-764 [PMID:28044345] Renau-Morata B, et al. Ectopic Expression of CDF3 Genes in Tomato Enhances Biomass Production and Yield under Salinity Stress Conditions. Front Plant Sci, 2017. 8: p. 660 [PMID:28515731] Henriques R, et al. The antiphasic regulatory module comprising CDF5 and its antisense RNA FLORE links the circadian clock to photoperiodic flowering. New Phytol., 2017. 216(3): p. 854-867 [PMID:28758689]