PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

EPS73701.1

Organism

Genlisea aurea

Taxonomic ID

192259

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea

Family

M-type_MADS

Protein Properties

Length: 81aa MW: 9422.86 Da PI: 10.2312

Description

M-type_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
EPS73701.1	genome	LSMU	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	102.7	1.4e-32	26	76	1	51
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krien++nrqvtf+kRrng+lKKA+ELSvLCdaeva+i+fss+g+lyey++ EPS73701.1 26 KRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYAN 76 79***********************************************85 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS50066	32.969	18	78	IPR002100	Transcription factor, MADS-box
SMART	SM00432	1.9E-40	18	77	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	4.9E-34	20	40	IPR002100	Transcription factor, MADS-box
CDD	cd00265	2.25E-37	20	77	No hit	No description
SuperFamily	SSF55455	4.32E-30	20	78	IPR002100	Transcription factor, MADS-box
PROSITE pattern	PS00350	0	20	74	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	8.7E-28	27	74	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	4.9E-34	40	55	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	4.9E-34	55	76	IPR002100	Transcription factor, MADS-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 81 aa Download sequence Send to blast
MELRSDITRD EVSSERKISR GKIEIKRIEN TTNRQVTFCK RRNGLLKKAY ELSVLCDAEV 60 ALIVFSSRGR LYEYANNRVL A

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1tqe_P	1e-20	18	80	1	66	Myocyte-specific enhancer factor 2B
1tqe_Q	1e-20	18	80	1	66	Myocyte-specific enhancer factor 2B
1tqe_R	1e-20	18	80	1	66	Myocyte-specific enhancer factor 2B
1tqe_S	1e-20	18	80	1	66	Myocyte-specific enhancer factor 2B
6c9l_A	1e-20	18	80	1	66	Myocyte-specific enhancer factor 2B
6c9l_B	1e-20	18	80	1	66	Myocyte-specific enhancer factor 2B
6c9l_C	1e-20	18	80	1	66	Myocyte-specific enhancer factor 2B
6c9l_D	1e-20	18	80	1	66	Myocyte-specific enhancer factor 2B
6c9l_E	1e-20	18	80	1	66	Myocyte-specific enhancer factor 2B
6c9l_F	1e-20	18	80	1	66	Myocyte-specific enhancer factor 2B
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor involved in regulating genes that determines stamen and carpel development in wild-type flowers. {ECO:0000250}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_016435583.1	1e-42	PREDICTED: floral homeotic protein AGAMOUS-like isoform X3
Refseq	XP_019233177.1	1e-42	PREDICTED: floral homeotic protein AGAMOUS isoform X1
Refseq	XP_019233178.1	1e-42	PREDICTED: floral homeotic protein AGAMOUS isoform X2
Refseq	XP_019233179.1	1e-42	PREDICTED: floral homeotic protein AGAMOUS isoform X2
Refseq	XP_019233180.1	1e-42	PREDICTED: floral homeotic protein AGAMOUS isoform X3
Swissprot	Q40885	2e-43	AG_PETHY; Floral homeotic protein AGAMOUS
TrEMBL	S8D8A8	2e-50	S8D8A8_9LAMI; Uncharacterized protein
STRING	XP_009802759.1	8e-42	(Nicotiana sylvestris)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA40	24	625

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G58780.2	2e-39	MIKC_MADS family protein

Publications ? help Back to Top
Immink RG, et al. Analysis of the petunia MADS-box transcription factor family. Mol. Genet. Genomics, 2003. 268(5): p. 598-606 [PMID:12589434] Leushkin EV, et al. The miniature genome of a carnivorous plant Genlisea aurea contains a low number of genes and short non-coding sequences. BMC Genomics, 2013. 14: p. 476 [PMID:23855885]