PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

EPS74220.1

Organism

Genlisea aurea

Taxonomic ID

192259

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea

Family

BES1

Protein Properties

Length: 97aa MW: 10977.5 Da PI: 10.7643

Description

BES1 family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
EPS74220.1	genome	LSMU	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	DUF822	106.7	4.3e-33	29	97	2	70
DUF822 2 gsgrkptwkErEnnkrRERrRRaiaakiyaGLRaqGnyklpkraDnneVlkALcreAGwvvedDGttyr 70 +s r p+++Er n++RERrRR +a ki+ GLRa G+y+lp +aD n+ l+ALc+eAGw v+dDGt+ r EPS74220.1 29 TSFRFPSERERLVNRQRERRRRSVAHKIFEGLRAGGGYELPRHADCNDLLRALCEEAGWHVDDDGTVSR 97 67899*************************************************************987 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Pfam	PF05687	2.5E-28	32	95	IPR008540	BES1/BZR1 plant transcription factor, N-terminal

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated

Sequence ? help Back to Top
Protein Sequence Length: 97 aa Download sequence Send to blast
NGCLPRGCIK GSKGPWLVRR ITKGGSMATS FRFPSERERL VNRQRERRRR SVAHKIFEGL 60 RAGGGYELPR HADCNDLLRA LCEEAGWHVD DDGTVSR

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
5zd4_A	6e-13	51	97	391	437	Maltose-binding periplasmic protein,Protein BRASSINAZOLE-RESISTANT 1
5zd4_B	6e-13	51	97	391	437	Maltose-binding periplasmic protein,Protein BRASSINAZOLE-RESISTANT 1
5zd4_C	6e-13	51	97	391	437	Maltose-binding periplasmic protein,Protein BRASSINAZOLE-RESISTANT 1
5zd4_D	6e-13	51	97	391	437	Maltose-binding periplasmic protein,Protein BRASSINAZOLE-RESISTANT 1
Search in ModeBase

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_012831787.1	4e-46	PREDICTED: BES1/BZR1 homolog protein 1-like
Swissprot	Q9S7F3	2e-14	BEH1_ARATH; BES1/BZR1 homolog protein 1
TrEMBL	S8D485	2e-64	S8D485_9LAMI; Uncharacterized protein (Fragment)
STRING	Migut.J00102.1.p	2e-45	(Erythranthe guttata)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA6204	21	30

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G50750.1	4e-16	BES1/BZR1 homolog 1

Publications ? help Back to Top
Leushkin EV, et al. The miniature genome of a carnivorous plant Genlisea aurea contains a low number of genes and short non-coding sequences. BMC Genomics, 2013. 14: p. 476 [PMID:23855885]