![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | EPS74236.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea
|
||||||||
| Family | SBP | ||||||||
| Protein Properties | Length: 109aa MW: 12040.1 Da PI: 10.2968 | ||||||||
| Description | SBP family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SBP | 124.8 | 3.5e-39 | 21 | 95 | 2 | 76 |
-SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S- CS
SBP 2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkk 76
Cqv+gC +dl+e+k ++ rhkvC +hsk+++vl++g+e rfCqqCsrfh+l efD+ekrsCrr+La hn+rrrk
EPS74236.1 21 CQVDGCGVDLAETKGFYCRHKVCPMHSKCAAVLIAGVEMRFCQQCSRFHQLAEFDKEKRSCRRKLAAHNQRRRKI 95
*************************************************************************96 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:4.10.1100.10 | 1.6E-31 | 14 | 82 | IPR004333 | Transcription factor, SBP-box |
| PROSITE profile | PS51141 | 29.479 | 18 | 95 | IPR004333 | Transcription factor, SBP-box |
| SuperFamily | SSF103612 | 1.15E-36 | 19 | 98 | IPR004333 | Transcription factor, SBP-box |
| Pfam | PF03110 | 1.1E-31 | 21 | 94 | IPR004333 | Transcription factor, SBP-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 109 aa Download sequence Send to blast |
KKSKSSAVGA VQYGGKAPPK CQVDGCGVDL AETKGFYCRH KVCPMHSKCA AVLIAGVEMR 60 FCQQCSRFHQ LAEFDKEKRS CRRKLAAHNQ RRRKIPPGEA MVASIFGNL |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1ul4_A | 7e-29 | 14 | 94 | 4 | 84 | squamosa promoter binding protein-like 4 |
| Search in ModeBase | ||||||
| Nucleic Localization Signal ? help Back to Top | |||
|---|---|---|---|
| No. | Start | End | Sequence |
| 1 | 81 | 92 | RRKLAAHNQRRR |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Trans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3'. {ECO:0000250}. | |||||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Negatively regulated by microRNAs miR156 and miR157. {ECO:0000305|PubMed:12202040}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_009391832.1 | 9e-41 | PREDICTED: squamosa promoter-binding-like protein 14 | ||||
| Swissprot | Q700W2 | 2e-36 | SPL9_ARATH; Squamosa promoter-binding-like protein 9 | ||||
| TrEMBL | S8D9M6 | 2e-74 | S8D9M6_9LAMI; Uncharacterized protein (Fragment) | ||||
| STRING | VIT_08s0007g06270.t01 | 3e-39 | (Vitis vinifera) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Asterids | OGEA749 | 24 | 105 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G42200.1 | 1e-38 | squamosa promoter binding protein-like 9 | ||||




