![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | EPS74389.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea
|
||||||||
| Family | LBD | ||||||||
| Protein Properties | Length: 101aa MW: 11550.3 Da PI: 9.0671 | ||||||||
| Description | LBD family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | DUF260 | 130.1 | 9.6e-41 | 1 | 100 | 1 | 100 |
DUF260 1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallke 99
+CaaC++lrr+C++dC++apyfpa++p++f +vh+++Gasnv k+l++lpe+ r +a++sl yeA +r++dPvyG vg+i+ l+qq++ ++ +la++++
EPS74389.1 1 RCAACRHLRRRCPSDCIFAPYFPANNPRRFSYVHRIYGASNVAKILQDLPENVRGEAADSLHYEAYCRIKDPVYGIVGMITVLHQQICAAQRHLARVHA 99
6**********************************************************************************************9998 PP
DUF260 100 e 100
e
EPS74389.1 100 E 100
7 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50891 | 24.132 | 1 | 101 | IPR004883 | Lateral organ boundaries, LOB |
| Pfam | PF03195 | 4.8E-39 | 1 | 98 | IPR004883 | Lateral organ boundaries, LOB |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0016020 | Cellular Component | membrane | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 101 aa Download sequence Send to blast |
RCAACRHLRR RCPSDCIFAP YFPANNPRRF SYVHRIYGAS NVAKILQDLP ENVRGEAADS 60 LHYEAYCRIK DPVYGIVGMI TVLHQQICAA QRHLARVHAE I |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5ly0_A | 3e-34 | 2 | 101 | 12 | 111 | LOB family transfactor Ramosa2.1 |
| 5ly0_B | 3e-34 | 2 | 101 | 12 | 111 | LOB family transfactor Ramosa2.1 |
| Search in ModeBase | ||||||
| Binding Motif ? help Back to Top | |||
|---|---|---|---|
| Motif ID | Method | Source | Motif file |
| MP00381 | DAP | Transfer from AT3G26620 | Download |
| |||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | Retrieve | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_011098999.1 | 2e-55 | LOB domain-containing protein 23-like | ||||
| Swissprot | P59468 | 3e-43 | LBD24_ARATH; LOB domain-containing protein 24 | ||||
| TrEMBL | S8D3V3 | 4e-68 | S8D3V3_9LAMI; Uncharacterized protein (Fragment) | ||||
| STRING | evm.model.supercontig_1.339 | 8e-50 | (Carica papaya) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Asterids | OGEA5277 | 20 | 39 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G26660.1 | 6e-37 | LOB domain-containing protein 24 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




