PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

EPS74412.1

Organism

Genlisea aurea

Taxonomic ID

192259

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea

Family

CAMTA

Protein Properties

Length: 126aa MW: 15470.5 Da PI: 10.2045

Description

CAMTA family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
EPS74412.1	genome	LSMU	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	CG-1	182.2	5.9e-57	6	122	2	118
CG-1 2 lkekkrwlkneeiaaiLenfekheltlelktrpksgsliLynrkkvryfrkDGyswkkkkdgktvrEdhekLKvggvevlycyYahseenptfqrrcyw 100 l+ ++rwl++ ei +iLenf++++++ e+++rp+sgs++L++rk+ ryfr+DG++w+kk+dgktv+E+he+LKvg+v+vl+cyYah+e+n+ fqrr+yw EPS74412.1 6 LEAQNRWLRPAEISRILENFQNFQIAREPPNRPPSGSVFLFDRKQHRYFRRDGHNWRKKRDGKTVKEAHERLKVGSVDVLHCYYAHGEDNECFQRRSYW 104 5679********************************************************************************************* PP CG-1 101 lLeeelekivlvhylevk 118 lL+ee+++iv+vhy+++k EPS74412.1 105 LLDEERSNIVFVHYRDTK 122 *************985 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51437	75.728	1	126	IPR005559	CG-1 DNA-binding domain
SMART	SM01076	1.5E-74	4	122	IPR005559	CG-1 DNA-binding domain
Pfam	PF03859	3.2E-50	7	120	IPR005559	CG-1 DNA-binding domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 126 aa Download sequence Send to blast
IHRILLEAQN RWLRPAEISR ILENFQNFQI AREPPNRPPS GSVFLFDRKQ HRYFRRDGHN 60 WRKKRDGKTV KEAHERLKVG SVDVLHCYYA HGEDNECFQR RSYWLLDEER SNIVFVHYRD 120 TKYMKQ

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription activator that binds to the DNA consensus sequence 5'-[ACG]CGCG[GTC]-3' (By similarity). Regulates transcriptional activity in response to calcium signals (Probable). Binds calmodulin in a calcium-dependent manner (By similarity). Involved in freezing tolerance in association with CAMTA1 and CAMTA3. Contributes together with CAMTA1 and CAMTA3 to the positive regulation of the cold-induced expression of DREB1A/CBF3, DREB1B/CBF1 and DREB1C/CBF2 (PubMed:23581962). Involved together with CAMTA3 and CAMTA4 in the positive regulation of a general stress response (PubMed:25039701). Involved in tolerance to aluminum. Binds to the promoter of ALMT1 transporter and contributes to the positive regulation of aluminum-induced expression of ALMT1 (PubMed:25627216). {ECO:0000250\|UniProtKB:Q8GSA7, ECO:0000269\|PubMed:23581962, ECO:0000269\|PubMed:25039701, ECO:0000269\|PubMed:25627216, ECO:0000305\|PubMed:11925432}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By salt, wounding, abscisic acid, H(2)O(2) and salicylic acid (PubMed:12218065). Induced by aluminum (PubMed:25627216). {ECO:0000269\|PubMed:12218065, ECO:0000269\|PubMed:25627216}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_009385634.1	3e-67	PREDICTED: calmodulin-binding transcription activator 2
Refseq	XP_009385635.1	3e-67	PREDICTED: calmodulin-binding transcription activator 2
Refseq	XP_009385636.1	3e-67	PREDICTED: calmodulin-binding transcription activator 2
Refseq	XP_018676769.1	3e-67	PREDICTED: calmodulin-binding transcription activator 2
Refseq	XP_018676770.1	3e-67	PREDICTED: calmodulin-binding transcription activator 2
Swissprot	Q6NPP4	5e-61	CMTA2_ARATH; Calmodulin-binding transcription activator 2
TrEMBL	S8ENI9	1e-89	S8ENI9_9LAMI; Calmodulin-binding protein (Fragment)
STRING	GSMUA_AchrUn_randomP02100_001	4e-66	(Musa acuminata)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA14489	8	11

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G64220.2	2e-63	Calmodulin-binding transcription activator protein with CG-1 and Ankyrin domains

Publications ? help Back to Top
Leushkin EV, et al. The miniature genome of a carnivorous plant Genlisea aurea contains a low number of genes and short non-coding sequences. BMC Genomics, 2013. 14: p. 476 [PMID:23855885] Benn G, et al. A key general stress response motif is regulated non-uniformly by CAMTA transcription factors. Plant J., 2014. 80(1): p. 82-92 [PMID:25039701] Kidokoro S, et al. Different Cold-Signaling Pathways Function in the Responses to Rapid and Gradual Decreases in Temperature. Plant Cell, 2017. 29(4): p. 760-774 [PMID:28351986]