PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Home  TFext  BLAST  Prediction  Download  Help  About  Links  PlantRegMap
(e.g., LFY)
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EPS74434.1
Organism
Genlisea aurea
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea
Family M-type_MADS
Protein Properties Length: 61aa    MW: 7036.29 Da    PI: 11.597
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EPS74434.1genomeLSMUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF78.83.9e-251160251
                ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
      SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                +i++ + rqvtfskRr+g+ KKA EL +LC+aevav++f+s+gkly yss
  EPS74434.1 11 KINDITARQVTFSKRRQGLVKKARELAILCEAEVAVVVFASSGKLYHYSS 60
                688999******************************************96 PP
Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006628.09261IPR002100Transcription factor, MADS-box
SuperFamilySSF554552.35E-25260IPR002100Transcription factor, MADS-box
SMARTSM004323.6E-34261IPR002100Transcription factor, MADS-box
PROSITE patternPS003500458IPR002100Transcription factor, MADS-box
PRINTSPR004047.7E-25424IPR002100Transcription factor, MADS-box
PfamPF003191.5E-241158IPR002100Transcription factor, MADS-box
PRINTSPR004047.7E-252439IPR002100Transcription factor, MADS-box
PRINTSPR004047.7E-253960IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 61 aa     Download sequence    Send to blast
RMTRRKIQIR KINDITARQV TFSKRRQGLV KKARELAILC EAEVAVVVFA SSGKLYHYSS  60
N
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6byy_A4e-18260159MEF2 CHIMERA
6byy_B4e-18260159MEF2 CHIMERA
6byy_C4e-18260159MEF2 CHIMERA
6byy_D4e-18260159MEF2 CHIMERA
6bz1_A5e-18260159MEF2 CHIMERA
6bz1_B5e-18260159MEF2 CHIMERA
6bz1_C5e-18260159MEF2 CHIMERA
6bz1_D5e-18260159MEF2 CHIMERA
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. Required for root plasticity in response to nitrate, NO(3)(-). Promotes lateral root growth in a NRT1.1-dependent manner. {ECO:0000269|PubMed:15667327, ECO:0000269|PubMed:17148611, ECO:0000269|PubMed:9430595}.
UniProtPutative transcription factor that coordinates gene expression underlying the differentiation of the pedicel abscission zone. May also be involved in the maintenance of the inflorescence meristem state.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by nitrate in root cell culture, (PubMed:9430595, PubMed:17148611). In roots, seems induced by nitrogen (N) deprivation (e.g. nitrate free medium) but rapidly repressed by N re-supply (e.g. nitrate, glutamine and ammonium) (PubMed:16021502). Slight repression in shoots during nitrogen (N) deprivation. {ECO:0000269|PubMed:16021502, ECO:0000269|PubMed:17148611, ECO:0000269|PubMed:9430595}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_028754544.11e-24MADS-box protein JOINTLESS-like
RefseqXP_028769650.11e-24MADS-box protein JOINTLESS-like
RefseqXP_028769651.11e-24MADS-box protein JOINTLESS-like
SwissprotQ9FUY61e-22JOIN_SOLLC; MADS-box protein JOINTLESS
SwissprotQ9SI389e-23ANR1_ARATH; MADS-box transcription factor ANR1
TrEMBLS8D3Y07e-36S8D3Y0_9LAMI; Uncharacterized protein (Fragment)
STRINGEMJ004397e-24(Prunus persica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA4024625
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G22540.11e-19MIKC_MADS family protein
Publications ? help Back to Top
  1. Heyndrickx KS,Vandepoele K
    Systematic identification of functional plant modules through the integration of complementary data sources.
    Plant Physiol., 2012. 159(3): p. 884-901
    [PMID:22589469]
  2. Leushkin EV, et al.
    The miniature genome of a carnivorous plant Genlisea aurea contains a low number of genes and short non-coding sequences.
    BMC Genomics, 2013. 14: p. 476
    [PMID:23855885]
  3. Yan Y,Wang H,Hamera S,Chen X,Fang R
    miR444a has multiple functions in the rice nitrate-signaling pathway.
    Plant J., 2014. 78(1): p. 44-55
    [PMID:24460537]
  4. Nakano T,Kato H,Shima Y,Ito Y
    Apple SVP Family MADS-Box Proteins and the Tomato Pedicel Abscission Zone Regulator JOINTLESS have Similar Molecular Activities.
    Plant Cell Physiol., 2015. 56(6): p. 1097-106
    [PMID:25746985]
  5. Lei L, et al.
    Nitrogen use efficiency is regulated by interacting proteins relevant to development in wheat.
    Plant Biotechnol. J., 2018. 16(6): p. 1214-1226
    [PMID:29193541]
  6. Sun CH, et al.
    Chrysanthemum MADS-box transcription factor CmANR1 modulates lateral root development via homo-/heterodimerization to influence auxin accumulation in Arabidopsis.
    Plant Sci., 2018. 266: p. 27-36
    [PMID:29241564]