![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | EcC000338.10 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
|
||||||||
| Family | YABBY | ||||||||
| Protein Properties | Length: 80aa MW: 9091.29 Da PI: 9.3137 | ||||||||
| Description | YABBY family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | YABBY | 124.1 | 2e-38 | 10 | 62 | 118 | 170 |
YABBY 118 PPekrqrvPsaynrfikeeiqrikasnPdishreafsaaaknWahfPkihfgl 170
PekrqrvPsayn+fikeeiqrikasnPdishreafs+aaknWahfP+ihfgl
EcC000338.10 10 APEKRQRVPSAYNQFIKEEIQRIKASNPDISHREAFSTAAKNWAHFPHIHFGL 62
6**************************************************97 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SuperFamily | SSF47095 | 2.36E-8 | 10 | 56 | IPR009071 | High mobility group box domain |
| Pfam | PF04690 | 1.4E-36 | 10 | 62 | IPR006780 | YABBY protein |
| Gene3D | G3DSA:1.10.30.10 | 3.2E-5 | 11 | 54 | IPR009071 | High mobility group box domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0007275 | Biological Process | multicellular organism development | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 80 aa Download sequence Send to blast |
MSCSFLGFAA PEKRQRVPSA YNQFIKEEIQ RIKASNPDIS HREAFSTAAK NWAHFPHIHF 60 GLMLDNNNQA KMDNVSSSLL |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Promotes adaxial cell identity. Regulates the initiation of embryonic shoot apical meristem (SAM) development. {ECO:0000269|PubMed:19837869}. | |||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_010048072.1 | 1e-41 | PREDICTED: axial regulator YABBY 5 | ||||
| Swissprot | Q8GW46 | 1e-37 | YAB5_ARATH; Axial regulator YABBY 5 | ||||
| TrEMBL | A0A059CQE3 | 2e-41 | A0A059CQE3_EUCGR; Uncharacterized protein | ||||
| STRING | XP_010048072.1 | 4e-41 | (Eucalyptus grandis) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM5538 | 26 | 49 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G26580.2 | 5e-40 | YABBY family protein | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




