PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

EcC000408.10

Organism

Eucalyptus camaldulensis

Taxonomic ID

34316

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus

Family

MYB

Protein Properties

Length: 146aa MW: 17015.5 Da PI: 10.2561

Description

MYB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
EcC000408.10	genome	ECGD	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	47.8	3.3e-15	19	65	2	48
SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 g+W++eEd++lv ++k++G +W+ a+ g+ Rt+k+c++rw +yl EcC000408.10 19 GAWSAEEDQKLVAYIKRYGIWNWTHMAEPAGLARTGKSCRLRWMNYL 65 89***************99**********************97 PP
2	Myb_DNA-binding	54.5	2.7e-17	72	114	2	46
SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS Myb_DNA-binding 2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 g+ T+eE+e+++++++ lG++ W++Ia++++ gRt++++k++w++ EcC000408.10 72 GNITQEEEEIIINLHRVLGNR-WASIASRLP-GRTDNEIKNYWNT 114 678****************.*****.*********97 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51294	15.128	13	65	IPR017930	Myb domain
SuperFamily	SSF46689	1.15E-29	16	112	IPR009057	Homeodomain-like
SMART	SM00717	4.7E-10	17	67	IPR001005	SANT/Myb domain
Pfam	PF00249	2.2E-13	18	65	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	9.9E-24	19	72	IPR009057	Homeodomain-like
CDD	cd00167	1.59E-9	20	65	No hit	No description
PROSITE profile	PS51294	23.451	66	120	IPR017930	Myb domain
SMART	SM00717	2.7E-16	70	118	IPR001005	SANT/Myb domain
Pfam	PF00249	2.6E-15	72	114	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	1.7E-25	73	118	IPR009057	Homeodomain-like
CDD	cd00167	4.32E-7	84	116	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 146 aa Download sequence Send to blast
MARFPRVDKS NSKKTVKTGA WSAEEDQKLV AYIKRYGIWN WTHMAEPAGL ARTGKSCRLR 60 WMNYLRPNIK HGNITQEEEE IIINLHRVLG NRWASIASRL PGRTDNEIKN YWNTRLKKCF 120 LMENLQMPTA CDVKVNSNHN DPLSCQ

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1a5j_A	3e-31	19	118	8	106	B-MYB
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor. {ECO:0000305}.
UniProt	Transcription repressor involved in regulation of protection against UV. Mediates transcriptional repression of CYP73A5, the gene encoding trans-cinnamate 4-monooxygenase, thereby regulating the accumulation of the UV-protectant compound sinapoylmalate. {ECO:0000269\|PubMed:11080161}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Down-regulated by exposure to UV-B light. {ECO:0000269\|PubMed:11080161}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_010030551.1	1e-105	PREDICTED: myb-related protein 308-like
Swissprot	P81393	3e-45	MYB08_ANTMA; Myb-related protein 308
Swissprot	Q9SZP1	6e-45	MYB4_ARATH; Transcription repressor MYB4
TrEMBL	A0A059CB38	2e-92	A0A059CB38_EUCGR; Uncharacterized protein
STRING	XP_010030551.1	1e-105	(Eucalyptus grandis)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM4	28	2646

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G13540.1	2e-42	myb domain protein 5

Publications ? help Back to Top
Jackson D,Culianez-Macia F,Prescott AG,Roberts K,Martin C Expression patterns of myb genes from Antirrhinum flowers. Plant Cell, 1991. 3(2): p. 115-25 [PMID:1840903] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Schenke D,Cai D,Scheel D Suppression of UV-B stress responses by flg22 is regulated at the chromatin level via histone modification. Plant Cell Environ., 2014. 37(7): p. 1716-21 [PMID:24450952] Zhou M, et al. Changing a conserved amino acid in R2R3-MYB transcription repressors results in cytoplasmic accumulation and abolishes their repressive activity in Arabidopsis. Plant J., 2015. 84(2): p. 395-403 [PMID:26332741] Zhang J, et al. Soybean SPX1 is an important component of the response to phosphate deficiency for phosphorus homeostasis. Plant Sci., 2016. 248: p. 82-91 [PMID:27181950] Zhou M, et al. LNK1 and LNK2 Corepressors Interact with the MYB3 Transcription Factor in Phenylpropanoid Biosynthesis. Plant Physiol., 2017. 174(3): p. 1348-1358 [PMID:28483877] Mondal SK,Roy S Genome-wide sequential, evolutionary, organizational and expression analyses of phenylpropanoid biosynthesis associated MYB domain transcription factors in Arabidopsis. J. Biomol. Struct. Dyn., 2018. 36(6): p. 1577-1601 [PMID:28490275] Verma N,Burma PK Regulation of tapetum-specific A9 promoter by transcription factors AtMYB80, AtMYB1 and AtMYB4 in Arabidopsis thaliana and Nicotiana tabacum. Plant J., 2017. 92(3): p. 481-494 [PMID:28849604]