![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | EcC002249.10 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
|
||||||||
| Family | MYB | ||||||||
| Protein Properties | Length: 119aa MW: 14057.4 Da PI: 11.3078 | ||||||||
| Description | MYB family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 47.5 | 4.1e-15 | 18 | 65 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
+g+W++eEd++lv +++++G +W+ ++ g+ Rt+k+c++rw +yl
EcC002249.10 18 KGAWSAEEDQKLVAYIRRYGIWNWTHMPKPAGLARTGKSCRLRWMNYL 65
79******************99************************97 PP
| |||||||
| 2 | Myb_DNA-binding | 48.5 | 2e-15 | 76 | 114 | 6 | 46 |
HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
Myb_DNA-binding 6 teEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
++E++l+++++++lG++ W++Ia++++ gRt++++k++w++
EcC002249.10 76 KQEEDLIIELHRLLGNK-WAAIAARLP-GRTDNEIKNYWNT 114
68***************.*********.***********97 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS51294 | 16.131 | 13 | 65 | IPR017930 | Myb domain |
| SuperFamily | SSF46689 | 1.98E-29 | 16 | 112 | IPR009057 | Homeodomain-like |
| SMART | SM00717 | 9.9E-10 | 17 | 67 | IPR001005 | SANT/Myb domain |
| Pfam | PF00249 | 4.0E-13 | 18 | 65 | IPR001005 | SANT/Myb domain |
| Gene3D | G3DSA:1.10.10.60 | 2.1E-21 | 19 | 72 | IPR009057 | Homeodomain-like |
| CDD | cd00167 | 3.43E-8 | 20 | 65 | No hit | No description |
| PROSITE profile | PS51294 | 23.806 | 66 | 119 | IPR017930 | Myb domain |
| SMART | SM00717 | 1.1E-13 | 70 | 118 | IPR001005 | SANT/Myb domain |
| Gene3D | G3DSA:1.10.10.60 | 4.9E-24 | 73 | 118 | IPR009057 | Homeodomain-like |
| Pfam | PF00249 | 1.4E-14 | 76 | 114 | IPR001005 | SANT/Myb domain |
| CDD | cd00167 | 1.31E-9 | 76 | 116 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 119 aa Download sequence Send to blast |
MVRRPLIPNK NCNPTVKKGA WSAEEDQKLV AYIRRYGIWN WTHMPKPAGL ARTGKSCRLR 60 WMNYLRPNIR HGNIAKQEED LIIELHRLLG NKWAAIAARL PGRTDNEIKN YWNTRLKKR |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1a5j_A | 9e-30 | 14 | 119 | 3 | 107 | B-MYB |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription factor that may function in osmotic stress and wounding signaling pathways (Probable). Contributes to basal resistance against the herbivore Pieris rapae (white cabbage butterfly) feeding (PubMed:19517001). {ECO:0000269|PubMed:19517001, ECO:0000305|PubMed:12857823}. | |||||
| UniProt | Transcriptional activator involved in cold stress response (PubMed:14675437, PubMed:20807373, PubMed:22246661). Regulates positively the expression of genes involved in reactive oxygen species (ROS) scavenging such as peroxidase and superoxide dismutase during cold stress. Transactivates a complex gene network that have major effects on stress tolerance and panicle development (PubMed:20807373). {ECO:0000269|PubMed:14675437, ECO:0000269|PubMed:20807373, ECO:0000269|PubMed:22246661}. | |||||
| UniProt | Transcription factor involved in salt stress response. Confers tolerance to salt stress (PubMed:22575450). Involved in distinct cellular processes in response to osmotic stress, including control of primary metabolism and negative regulation of short-term transcriptional responses to osmotic stress (PubMed:19211694). Can activate the steps necessary for aliphatic suberin synthesis and deposition of cell wall-associated suberin-like lamellae. Involved in the production of aliphatic suberin under abiotic stress conditions (PubMed:25060192). {ECO:0000269|PubMed:19211694, ECO:0000269|PubMed:22575450, ECO:0000269|PubMed:25060192}. | |||||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: By cold stress. {ECO:0000269|PubMed:14675437, ECO:0000269|PubMed:20807373, ECO:0000269|Ref.2}. | |||||
| UniProt | INDUCTION: Induced by light (PubMed:8980549). Induced by wounding, salt stress and abscisic acid (PubMed:12857823). Induced by the lepidopteran herbivore Pieris rapae (white cabbage butterfly) feeding (PubMed:19517001). {ECO:0000269|PubMed:12857823, ECO:0000269|PubMed:19517001, ECO:0000269|PubMed:8980549}. | |||||
| UniProt | INDUCTION: Induced by salt stress (PubMed:19211694, PubMed:25060192). Induced by osmotic stress (PubMed:19211694). Induced by abscisic acid (PubMed:25060192). {ECO:0000269|PubMed:19211694, ECO:0000269|PubMed:25060192}. | |||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_010051858.1 | 5e-82 | PREDICTED: transcription factor MYB23-like | ||||
| Swissprot | Q7XBH4 | 4e-47 | MYB4_ORYSJ; Transcription factor MYB4 | ||||
| Swissprot | Q9LDR8 | 1e-46 | MY102_ARATH; Transcription factor MYB102 | ||||
| Swissprot | Q9M0J5 | 4e-47 | MYB41_ARATH; Transcription factor MYB41 | ||||
| TrEMBL | A0A059CCL1 | 1e-70 | A0A059CCL1_EUCGR; Uncharacterized protein | ||||
| STRING | XP_010051858.1 | 2e-81 | (Eucalyptus grandis) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM4 | 28 | 2646 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT4G28110.1 | 2e-49 | myb domain protein 41 | ||||




