![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | EcC003705.30 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
|
||||||||
| Family | GATA | ||||||||
| Protein Properties | Length: 118aa MW: 13336 Da PI: 9.9595 | ||||||||
| Description | GATA family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | GATA | 58.6 | 8.5e-19 | 31 | 64 | 1 | 34 |
GATA 1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34
C++C +t++p+WR gp g+ktLCnaCG++y+ +
EcC003705.30 31 CVHCAATESPMWRLGPMGPKTLCNACGIRYKTGR 64
*******************************887 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00401 | 1.1E-15 | 25 | 75 | IPR000679 | Zinc finger, GATA-type |
| PROSITE profile | PS50114 | 12.479 | 25 | 61 | IPR000679 | Zinc finger, GATA-type |
| SuperFamily | SSF57716 | 1.14E-15 | 26 | 87 | No hit | No description |
| Gene3D | G3DSA:3.30.50.10 | 2.5E-15 | 29 | 63 | IPR013088 | Zinc finger, NHR/GATA-type |
| CDD | cd00202 | 9.55E-13 | 30 | 77 | No hit | No description |
| Pfam | PF00320 | 1.6E-16 | 31 | 64 | IPR000679 | Zinc finger, GATA-type |
| PROSITE pattern | PS00344 | 0 | 31 | 56 | IPR000679 | Zinc finger, GATA-type |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0055085 | Biological Process | transmembrane transport | ||||
| GO:0016021 | Cellular Component | integral component of membrane | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0005515 | Molecular Function | protein binding | ||||
| GO:0008270 | Molecular Function | zinc ion binding | ||||
| GO:0022857 | Molecular Function | transmembrane transporter activity | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 118 aa Download sequence Send to blast |
SSLQEKPQDP AKRRRKEEDQ SPQQPNQPRR CVHCAATESP MWRLGPMGPK TLCNACGIRY 60 KTGRLFPEYR PSASPTYVPS LHSHFHKKVI RIREATNGED TEVAANAQRP SQLGNIES |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcriptional activator that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters. May be involved in the regulation of some light-responsive genes (By similarity). {ECO:0000250}. | |||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_018719792.1 | 4e-83 | PREDICTED: GATA transcription factor 8-like | ||||
| Swissprot | Q9SV30 | 8e-32 | GATA8_ARATH; GATA transcription factor 8 | ||||
| TrEMBL | A0A484N6A9 | 6e-34 | A0A484N6A9_9ASTE; Uncharacterized protein | ||||
| STRING | XP_010046437.1 | 6e-83 | (Eucalyptus grandis) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G54810.2 | 3e-34 | GATA family protein | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




