![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | EcC004476.30 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
|
||||||||
| Family | M-type_MADS | ||||||||
| Protein Properties | Length: 79aa MW: 8824.24 Da PI: 10.1733 | ||||||||
| Description | M-type_MADS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SRF-TF | 42.2 | 1e-13 | 10 | 58 | 2 | 50 |
---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
SRF-TF 2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
+i+n + r vt+ + + g+ A ELS LC+++v +iifs++g l +
EcC004476.30 10 KIDNPTGRLVTYRRCKDGLVQNAAELSKLCGTNVGLIIFSPNGGLISFT 58
79*****************************************999886 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SuperFamily | SSF55455 | 8.11E-18 | 1 | 69 | IPR002100 | Transcription factor, MADS-box |
| PROSITE profile | PS50066 | 20.198 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
| SMART | SM00432 | 7.1E-15 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 7.4E-13 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF00319 | 1.4E-14 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 7.4E-13 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 7.4E-13 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0000911 | Biological Process | cytokinesis by cell plate formation | ||||
| GO:0006412 | Biological Process | translation | ||||
| GO:0009965 | Biological Process | leaf morphogenesis | ||||
| GO:0010090 | Biological Process | trichome morphogenesis | ||||
| GO:0005730 | Cellular Component | nucleolus | ||||
| GO:0005783 | Cellular Component | endoplasmic reticulum | ||||
| GO:0016020 | Cellular Component | membrane | ||||
| GO:0022627 | Cellular Component | cytosolic small ribosomal subunit | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0003735 | Molecular Function | structural constituent of ribosome | ||||
| GO:0046983 | Molecular Function | protein dimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 79 aa Download sequence Send to blast |
MGRDKLAVQK IDNPTGRLVT YRRCKDGLVQ NAAELSKLCG TNVGLIIFSP NGGLISFTSS 60 SRSIIIKFFR LEEFFSYHP |
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_018720605.1 | 2e-24 | PREDICTED: agamous-like MADS-box protein AGL66 | ||||
| TrEMBL | A0A022RTQ0 | 6e-17 | A0A022RTQ0_ERYGU; Uncharacterized protein (Fragment) | ||||
| TrEMBL | A0A438FFJ8 | 3e-15 | A0A438FFJ8_VITVI; Agamous-like MADS-box protein AGL66 | ||||
| STRING | XP_010038635.1 | 2e-24 | (Eucalyptus grandis) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT4G37940.1 | 4e-14 | AGAMOUS-like 21 | ||||




