![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | EcC006970.30 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
|
||||||||
| Family | LBD | ||||||||
| Protein Properties | Length: 85aa MW: 9509.15 Da PI: 9.1229 | ||||||||
| Description | LBD family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | DUF260 | 63.1 | 7.2e-20 | 15 | 63 | 1 | 49 |
DUF260 1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkal 49
+C aCk+lrr+C++dCv+a yfpa++p+kfanvh +FGasnv k+ +
EcC006970.30 15 PCTACKLLRRRCVQDCVFALYFPANEPHKFANVHTVFGASNVNKMFQVC 63
7********************************************9865 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50891 | 15.076 | 14 | 85 | IPR004883 | Lateral organ boundaries, LOB |
| Pfam | PF03195 | 3.5E-19 | 15 | 64 | IPR004883 | Lateral organ boundaries, LOB |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 85 aa Download sequence Send to blast |
MKESGRGQKQ GTLLPCTACK LLRRRCVQDC VFALYFPANE PHKFANVHTV FGASNVNKMF 60 QVCPSFLSAF VFPLHSSSLT LPEFI |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5ly0_A | 3e-18 | 11 | 64 | 7 | 60 | LOB family transfactor Ramosa2.1 |
| 5ly0_B | 3e-18 | 11 | 64 | 7 | 60 | LOB family transfactor Ramosa2.1 |
| Search in ModeBase | ||||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_010056710.1 | 2e-30 | PREDICTED: LOB domain-containing protein 4 | ||||
| Swissprot | Q9SHE9 | 2e-27 | LBD4_ARATH; LOB domain-containing protein 4 | ||||
| TrEMBL | A0A172J1W3 | 7e-30 | A0A172J1W3_BOENI; Lateral organ boundaries domain protein | ||||
| STRING | XP_010056710.1 | 7e-30 | (Eucalyptus grandis) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G31320.1 | 9e-30 | LOB domain-containing protein 4 | ||||




