PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

EcC012535.10

Organism

Eucalyptus camaldulensis

Taxonomic ID

34316

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus

Family

MYB_related

Protein Properties

Length: 84aa MW: 9726.1 Da PI: 9.9284

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
EcC012535.10	genome	ECGD	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	36.5	1.1e-11	5	47	1	45
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 r+++++eE++l++++++ +Gg+ W+ Ia+ + t+ ++k++w+ EcC012535.10 5 RKAFSKEEEDLIIELHAVFGGR-WSEIAAQLR-AGTDDEIKNFWN 47 789*****************.*****.66*******8 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51294	15.568	1	54	IPR017930	Myb domain
SMART	SM00717	1.3E-7	4	52	IPR001005	SANT/Myb domain
Pfam	PF00249	2.1E-10	5	48	IPR001005	SANT/Myb domain
SuperFamily	SSF46689	9.79E-11	5	63	IPR009057	Homeodomain-like
CDD	cd00167	1.21E-6	7	47	No hit	No description
Gene3D	G3DSA:1.10.10.60	8.0E-16	7	48	IPR009057	Homeodomain-like

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 84 aa Download sequence Send to blast
LRKWRKAFSK EEEDLIIELH AVFGGRWSEI AAQLRAGTDD EIKNFWNSSH KKKLRQREID 60 PTTHKPLPVK SVLECNGSSL FVHA

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor that coordinates a small network of downstream target genes required for several aspects of plant growth and development, such as xylem formation and xylem cell differentiation, and lateral root formation (PubMed:22708996). Regulates a specific set of target genes by binding DNA to the AC cis-element 5'-ACCTAC-3' (PubMed:23741471). Functions as a transcriptional regulator of stomatal closure. Plays a role the regulation of stomatal pore size independently of abscisic acid (ABA) (PubMed:16005292). Required for seed coat mucilage deposition during the development of the seed coat epidermis (PubMed:19401413). Involved in the induction of trichome initiation and branching by positively regulating GL1 and GL2. Required for gibberellin (GA) biosynthesis and degradation by positively affecting the expression of the enzymes that convert GA9 into the bioactive GA4, as well as the enzymes involved in the degradation of GA4 (PubMed:28207974). {ECO:0000269\|PubMed:16005292, ECO:0000269\|PubMed:19401413, ECO:0000269\|PubMed:22708996, ECO:0000269\|PubMed:23741471, ECO:0000269\|PubMed:28207974}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_010910907.1	4e-26	transcription factor MYB61
Swissprot	Q8VZQ2	7e-24	MYB61_ARATH; Transcription factor MYB61
TrEMBL	A0A0C6WCU2	3e-25	A0A0C6WCU2_9POAL; ScMYB67 protein
STRING	cassava4.1_007846m	3e-24	(Manihot esculenta)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G09540.1	3e-26	myb domain protein 61

Publications ? help Back to Top
Heyndrickx KS,Vandepoele K Systematic identification of functional plant modules through the integration of complementary data sources. Plant Physiol., 2012. 159(3): p. 884-901 [PMID:22589469] Matías-Hernández L, et al. AaMYB1 and its orthologue AtMYB61 affect terpene metabolism and trichome development in Artemisia annua and Arabidopsis thaliana. Plant J., 2017. 90(3): p. 520-534 [PMID:28207974]