![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | EcC014020.20 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
|
||||||||
| Family | MYB_related | ||||||||
| Protein Properties | Length: 89aa MW: 10585.8 Da PI: 5.2836 | ||||||||
| Description | MYB_related family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 25 | 4.5e-08 | 33 | 71 | 5 | 45 |
-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
Myb_DNA-binding 5 TteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45
T++E++l+++ ++ G + W++Ia +++ gR ++++ +w
EcC014020.20 33 TEQEEDLIYRMYRLVGER-WDLIAGRVP-GRKAEEIERFWI 71
9*****************.*********.*********995 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00717 | 4.8E-4 | 28 | 76 | IPR001005 | SANT/Myb domain |
| Gene3D | G3DSA:1.10.10.60 | 9.8E-10 | 33 | 71 | IPR009057 | Homeodomain-like |
| CDD | cd00167 | 2.94E-5 | 33 | 70 | No hit | No description |
| Pfam | PF00249 | 1.7E-7 | 33 | 71 | IPR001005 | SANT/Myb domain |
| SuperFamily | SSF46689 | 5.3E-7 | 33 | 71 | IPR009057 | Homeodomain-like |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0005515 | Molecular Function | protein binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 89 aa Download sequence Send to blast |
MDERARKKAK KSSTSSTDSE EVSSIEWDVI TLTEQEEDLI YRMYRLVGER WDLIAGRVPG 60 RKAEEIERFW IMRHGEVYAE KRNDFNSKT |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor. Involved in epidermal cell fate specification. Negative regulator of trichome development, including endoreplication, by lateral inhibition involving intercellular interactions. Promotes the formation of hair developing cells (trichoblasts) in H position in root epidermis, probably by inhibiting non-hair cell (atrichoblasts) formation. {ECO:0000269|PubMed:10368181, ECO:0000269|PubMed:12356720}. | |||||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Negative autoregulation. Repressed by CPC. {ECO:0000269|PubMed:12356720}. | |||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_010053109.1 | 3e-44 | PREDICTED: transcription factor TRY-like | ||||
| Refseq | XP_010053110.1 | 3e-44 | PREDICTED: transcription factor TRY-like | ||||
| Refseq | XP_010053111.1 | 3e-44 | PREDICTED: transcription factor TRY-like | ||||
| Refseq | XP_018727771.1 | 3e-44 | PREDICTED: transcription factor TRY-like | ||||
| Swissprot | Q8GV05 | 6e-35 | TRY_ARATH; Transcription factor TRY | ||||
| TrEMBL | A0A2I4E811 | 4e-39 | A0A2I4E811_JUGRE; transcription factor CPC-like isoform X2 | ||||
| TrEMBL | A0A2I4E823 | 4e-39 | A0A2I4E823_JUGRE; transcription factor CPC-like isoform X1 | ||||
| STRING | XP_010053109.1 | 1e-43 | (Eucalyptus grandis) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G53200.1 | 2e-30 | MYB_related family protein | ||||




