![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | EcC014474.10 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
|
||||||||
| Family | MYB_related | ||||||||
| Protein Properties | Length: 79aa MW: 9284.5 Da PI: 10.3212 | ||||||||
| Description | MYB_related family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 54.7 | 2.4e-17 | 2 | 45 | 1 | 46 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
+++W+ eEd++l++ +k++G++ W+ Ia++++ gRt++ +k++w+
EcC014474.10 2 KDSWSVEEDKILIQSHKEMGTR-WAEIAKRLP-GRTENTIKNHWNA 45
679*******************.*********.***********95 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00717 | 4.2E-16 | 1 | 49 | IPR001005 | SANT/Myb domain |
| PROSITE profile | PS51294 | 23.601 | 1 | 51 | IPR017930 | Myb domain |
| Pfam | PF00249 | 3.5E-16 | 2 | 45 | IPR001005 | SANT/Myb domain |
| SuperFamily | SSF46689 | 1.72E-16 | 2 | 54 | IPR009057 | Homeodomain-like |
| Gene3D | G3DSA:1.10.10.60 | 3.1E-19 | 4 | 45 | IPR009057 | Homeodomain-like |
| CDD | cd00167 | 1.11E-12 | 4 | 47 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006352 | Biological Process | DNA-templated transcription, initiation | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 79 aa Download sequence Send to blast |
QKDSWSVEED KILIQSHKEM GTRWAEIAKR LPGRTENTIK NHWNAVKRRQ YCKQELLPHT 60 NSSNILQNYI RSVTTPSPP |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1idy_A | 5e-19 | 1 | 50 | 4 | 53 | MOUSE C-MYB DNA-BINDING DOMAIN REPEAT 3 |
| 1idz_A | 5e-19 | 1 | 50 | 4 | 53 | MOUSE C-MYB DNA-BINDING DOMAIN REPEAT 3 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription activator that recognizes the motif 5'-TAACGG-3' in the promoter of endosperm-induced genes (PubMed:27681170, PubMed:25194028, PubMed:19066902). Promotes vegetative-to-embryonic transition and the formation of somatic embryos from root explants in a WUS-independent manner but via the expression of embryonic genes (e.g. LEC1, LEC2, FUS3 and WUS) (PubMed:18695688). May play an important role during embryogenesis and seed maturation (PubMed:19066902, PubMed:25194028). Together with MYB115, activates the transcription of S-ACP-DES2/AAD2 and S-ACP-DES3/AAD3 thus promoting the biosynthesis of omega-7 monounsaturated fatty acid in seed endosperm (PubMed:27681170). Regulates negatively maturation genes in the endosperm (PubMed:25194028). {ECO:0000269|PubMed:18695688, ECO:0000269|PubMed:19066902, ECO:0000269|PubMed:25194028, ECO:0000269|PubMed:27681170}. | |||||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Induced by LEC2. {ECO:0000269|PubMed:25194028}. | |||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_010041992.1 | 7e-40 | PREDICTED: myb-like protein AA, partial | ||||
| Refseq | XP_018717996.1 | 3e-39 | PREDICTED: transcriptional activator Myb-like | ||||
| Swissprot | Q9LVW4 | 3e-26 | MY118_ARATH; Transcription factor MYB118 | ||||
| TrEMBL | A0A1Q3BIZ1 | 3e-26 | A0A1Q3BIZ1_CEPFO; Myb_DNA-bind_6 domain-containing protein | ||||
| STRING | XP_010030739.1 | 9e-39 | (Eucalyptus grandis) | ||||
| STRING | XP_010041992.1 | 3e-39 | (Eucalyptus grandis) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G27785.1 | 1e-28 | myb domain protein 118 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




