PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

EcC014963.10

Organism

Eucalyptus camaldulensis

Taxonomic ID

34316

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus

Family

NAC

Protein Properties

Length: 48aa MW: 5651.32 Da PI: 10.6336

Description

NAC family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
EcC014963.10	genome	ECGD	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NAM	50.9	5.2e-16	5	45	54	94
NAM 54 eekewyfFskrdkkyatgkrknratksgyWkatgkdkevls 94 + +ewyfFs rd+kyatg r+nrat++gyWkatgkd++v++ EcC014963.10 5 NASEWYFFSFRDRKYATGFRTNRATTTGYWKATGKDRTVHD 45 567***********************************986 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51005	19.344	1	48	IPR003441	NAC domain
SuperFamily	SSF101941	9.02E-16	3	45	IPR003441	NAC domain
Pfam	PF02365	3.2E-5	9	41	IPR003441	NAC domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 48 aa Download sequence Send to blast
MAKLNASEWY FFSFRDRKYA TGFRTNRATT TGYWKATGKD RTVHDPVT

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription activator. Involved in molecular mechanisms regulating shoot apical meristem (SAM) formation during embryogenesis and organ separation. Required for axillary meristem initiation and separation of the meristem from the main stem. May act as an inhibitor of cell division. {ECO:0000269\|PubMed:12837947, ECO:0000269\|PubMed:17122068}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By BRM, at the chromatin level, and conferring a very specific spatial expression pattern. {ECO:0000269\|PubMed:16854978}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_018827123.1	4e-25	PREDICTED: NAC domain-containing protein 21/22-like
Swissprot	Q9S851	4e-18	NAC31_ARATH; Protein CUP-SHAPED COTYLEDON 3
TrEMBL	A0A2I4F652	9e-24	A0A2I4F652_JUGRE; NAC domain-containing protein 21/22-like
STRING	XP_006479521.1	1e-23	(Citrus sinensis)
STRING	XP_006443820.1	1e-23	(Citrus clementina)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G28530.2	2e-27	NAC domain containing protein 74

Publications ? help Back to Top
Chen C, et al. Transcriptome profiling reveals roles of meristem regulators and polarity genes during fruit trichome development in cucumber (Cucumis sativus L.). J. Exp. Bot., 2014. 65(17): p. 4943-58 [PMID:24962999] Gonçalves B, et al. A conserved role for CUP-SHAPED COTYLEDON genes during ovule development. Plant J., 2015. 83(4): p. 732-42 [PMID:26119568] Balkunde R,Kitagawa M,Xu XM,Wang J,Jackson D SHOOT MERISTEMLESS trafficking controls axillary meristem formation, meristem size and organ boundaries in Arabidopsis. Plant J., 2017. 90(3): p. 435-446 [PMID:28161901] Espinosa-Ruiz A, et al. TOPLESS mediates brassinosteroid control of shoot boundaries and root meristem development in Arabidopsis thaliana. Development, 2017. 144(9): p. 1619-1628 [PMID:28320734] Koyama T,Sato F,Ohme-Takagi M Roles of miR319 and TCP Transcription Factors in Leaf Development. Plant Physiol., 2017. 175(2): p. 874-885 [PMID:28842549]