PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

EcC016164.20

Organism

Eucalyptus camaldulensis

Taxonomic ID

34316

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus

Family

MYB_related

Protein Properties

Length: 90aa MW: 10702.4 Da PI: 11.1302

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
EcC016164.20	genome	ECGD	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	48.5	2e-15	16	63	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g W++eEd++l+ +++++G +W+ a+ g+ Rt+k+c++rw ++l EcC016164.20 16 KGTWSPEEDQKLIAYIRRYGIWNWTQMAKPAGLARTGKSCRLRWMNHL 63 799***************99**********************97 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.10.60	1.7E-23	10	66	IPR009057	Homeodomain-like
PROSITE profile	PS51294	22.642	11	67	IPR017930	Myb domain
SMART	SM00717	2.8E-11	15	65	IPR001005	SANT/Myb domain
SuperFamily	SSF46689	7.98E-23	17	90	IPR009057	Homeodomain-like
CDD	cd00167	8.33E-10	18	63	No hit	No description
Pfam	PF13921	2.6E-15	19	78	No hit	No description
Gene3D	G3DSA:1.10.10.60	1.9E-8	67	90	IPR009057	Homeodomain-like
PROSITE profile	PS51294	8.568	68	90	IPR017930	Myb domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 90 aa Download sequence Send to blast
MVRRPGIDYD NNSLKKGTWS PEEDQKLIAY IRRYGIWNWT QMAKPAGLAR TGKSCRLRWM 60 NHLRPNVKRG NITKEEEEII IRLHRVLGNR

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1a5j_A	3e-20	13	90	4	80	B-MYB
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcriptional activator involved in cold stress response (PubMed:14675437, PubMed:20807373, PubMed:22246661). Regulates positively the expression of genes involved in reactive oxygen species (ROS) scavenging such as peroxidase and superoxide dismutase during cold stress. Transactivates a complex gene network that have major effects on stress tolerance and panicle development (PubMed:20807373). {ECO:0000269\|PubMed:14675437, ECO:0000269\|PubMed:20807373, ECO:0000269\|PubMed:22246661}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By cold stress. {ECO:0000269\|PubMed:14675437, ECO:0000269\|PubMed:20807373, ECO:0000269\|Ref.2}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_018728065.1	4e-44	PREDICTED: transcription factor WER-like
Swissprot	Q7XBH4	3e-30	MYB4_ORYSJ; Transcription factor MYB4
TrEMBL	A0A059CBD0	8e-43	A0A059CBD0_EUCGR; Uncharacterized protein
STRING	XP_010051856.1	7e-43	(Eucalyptus grandis)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G14750.1	1e-32	myb domain protein 66

Publications ? help Back to Top
Park MR, et al. Supra-optimal expression of the cold-regulated OsMyb4 transcription factor in transgenic rice changes the complexity of transcriptional network with major effects on stress tolerance and panicle development. Plant Cell Environ., 2010. 33(12): p. 2209-30 [PMID:20807373] Soltész A, et al. The rice Osmyb4 gene enhances tolerance to frost and improves germination under unfavourable conditions in transgenic barley plants. J. Appl. Genet., 2012. 53(2): p. 133-43 [PMID:22246661]