![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | EcC022275.10 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
|
||||||||
| Family | GATA | ||||||||
| Protein Properties | Length: 115aa MW: 13062.9 Da PI: 10.2467 | ||||||||
| Description | GATA family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | GATA | 54.5 | 1.6e-17 | 1 | 35 | 1 | 35 |
GATA 1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35
C +C + kTp+WR gp g+ktLCnaCG+++++ +l
EcC022275.10 1 CLHCASEKTPQWRTGPMGPKTLCNACGVRFKSGRL 35
99*****************************9885 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Pfam | PF00320 | 2.4E-15 | 1 | 35 | IPR000679 | Zinc finger, GATA-type |
| SuperFamily | SSF57716 | 6.18E-14 | 1 | 59 | No hit | No description |
| SMART | SM00401 | 9.5E-12 | 1 | 45 | IPR000679 | Zinc finger, GATA-type |
| CDD | cd00202 | 5.51E-12 | 1 | 47 | No hit | No description |
| Gene3D | G3DSA:3.30.50.10 | 2.5E-13 | 1 | 33 | IPR013088 | Zinc finger, NHR/GATA-type |
| PROSITE pattern | PS00344 | 0 | 1 | 26 | IPR000679 | Zinc finger, GATA-type |
| PROSITE profile | PS50114 | 11.358 | 1 | 31 | IPR000679 | Zinc finger, GATA-type |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0006886 | Biological Process | intracellular protein transport | ||||
| GO:0055085 | Biological Process | transmembrane transport | ||||
| GO:0031965 | Cellular Component | nuclear membrane | ||||
| GO:0000166 | Molecular Function | nucleotide binding | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0008270 | Molecular Function | zinc ion binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 115 aa Download sequence Send to blast |
CLHCASEKTP QWRTGPMGPK TLCNACGVRF KSGRLVPEYR PAASPTFVSA KHSNSHRKVL 60 ELRRQKELHR PHHHHHHHHQ PQQYFGQSPM FGMSAGGADE FLINHCGGPA YRHMI |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcriptional activator that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters. May be involved in the regulation of some light-responsive genes (By similarity). Transcription activator involved in xylem formation. Functions upstream of NAC030/VND7, a master switch of xylem vessel differentiation (PubMed:25265867). {ECO:0000250|UniProtKB:Q8LAU9, ECO:0000269|PubMed:25265867}. | |||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_010033845.1 | 2e-62 | PREDICTED: GATA transcription factor 12 | ||||
| Swissprot | P69781 | 2e-46 | GAT12_ARATH; GATA transcription factor 12 | ||||
| TrEMBL | A0A059AJU1 | 4e-61 | A0A059AJU1_EUCGR; GATA transcription factor | ||||
| STRING | XP_010033845.1 | 7e-62 | (Eucalyptus grandis) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G25830.1 | 2e-48 | GATA transcription factor 12 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




