![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | EcC026665.10 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
|
||||||||
| Family | G2-like | ||||||||
| Protein Properties | Length: 128aa MW: 14575.8 Da PI: 11.1035 | ||||||||
| Description | G2-like family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | G2-like | 87.6 | 1.2e-27 | 2 | 52 | 5 | 56 |
G2-like 5 rWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56
+WtpeLH+rFv+aveqL G +kA+P++ilelm++++Lt+++++SHLQkYR++
EcC026665.10 2 DWTPELHRRFVQAVEQL-GLDKAVPSRILELMGIDCLTRHNIASHLQKYRSH 52
7****************.********************************86 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS51294 | 17.779 | 1 | 54 | IPR017930 | Myb domain |
| TIGRFAMs | TIGR01557 | 2.2E-26 | 1 | 52 | IPR006447 | Myb domain, plants |
| Gene3D | G3DSA:1.10.10.60 | 3.1E-26 | 2 | 55 | IPR009057 | Homeodomain-like |
| SuperFamily | SSF46689 | 1.61E-18 | 2 | 55 | IPR009057 | Homeodomain-like |
| Pfam | PF00249 | 1.2E-8 | 2 | 50 | IPR001005 | SANT/Myb domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 128 aa Download sequence Send to blast |
VDWTPELHRR FVQAVEQLGL DKAVPSRILE LMGIDCLTRH NIASHLQKYR SHRKHMLARE 60 AEAANWSQRR HTHGNGGHKM RPDTMLVMSH STTPTNGSPW LAPATLGFPP VTPMPPHFRP 120 LHVWGHPP |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1irz_A | 4e-16 | 1 | 50 | 8 | 57 | ARR10-B |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcriptional activator that functions with GLK2 to promote chloroplast development. Acts as an activator of nuclear photosynthetic genes involved in chlorophyll biosynthesis, light harvesting, and electron transport. Acts in a cell-autonomous manner to coordinate and maintain the photosynthetic apparatus within individual cells. May function in photosynthetic capacity optimization by integrating responses to variable environmental and endogenous cues (PubMed:11828027, PubMed:12220263, PubMed:17533111, PubMed:18643989, PubMed:19376934, PubMed:19383092, PubMed:19726569). Prevents premature senescence (PubMed:23459204). {ECO:0000269|PubMed:11828027, ECO:0000269|PubMed:12220263, ECO:0000269|PubMed:17533111, ECO:0000269|PubMed:18643989, ECO:0000269|PubMed:19376934, ECO:0000269|PubMed:19383092, ECO:0000269|PubMed:19726569, ECO:0000269|PubMed:23459204}. | |||||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: By light. Repressed by BZR2. {ECO:0000269|PubMed:12220263, ECO:0000269|PubMed:21214652}. | |||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_010052247.1 | 8e-88 | PREDICTED: transcription activator GLK1 | ||||
| Swissprot | Q9SIV3 | 5e-46 | GLK1_ARATH; Transcription activator GLK1 | ||||
| TrEMBL | A0A059DGJ0 | 2e-86 | A0A059DGJ0_EUCGR; Uncharacterized protein | ||||
| STRING | XP_010052247.1 | 3e-87 | (Eucalyptus grandis) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM2209 | 27 | 73 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G20570.1 | 2e-48 | GBF's pro-rich region-interacting factor 1 | ||||




