PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EcC036012.20
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family ZF-HD
Protein Properties Length: 78aa    MW: 8552.58 Da    PI: 8.7991
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EcC036012.20genomeECGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer90.91.2e-282276358
   ZF-HD_dimer  3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreve 58
                  ++rY eC++NhAas+Ggh vDGC Ef p  g eg+  a++Ca CgCHRnFHR+ ve
  EcC036012.20 22 RIRYAECQRNHAASTGGHQVDGCTEFRPR-GVEGSDLAFTCATCGCHRNFHRKVVE 76
                  78**************************8.9999*******************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257743.0E-152076IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047702.0E-262375IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015661.1E-222473IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152323.4472574IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Sequence ? help Back to Top
Protein Sequence    Length: 78 aa     Download sequence    Send to blast
MKKVVLGRGE ESSSASSSRM PRIRYAECQR NHAASTGGHQ VDGCTEFRPR GVEGSDLAFT  60
CATCGCHRNF HRKVVENP
Functional Description ? help Back to Top
Source Description
UniProtInhibits zinc finger homeodomain (ZHD) transcription factors, such as ZHD5, by interacting with them to prevent both their nuclear localization and their DNA-binding properties. Involved in integrating signals from multiple hormones by preventing the expression of genes involved in gibberellic acid (GA), auxin and brassinosteroid signaling and by promoting the expression of abscisic acid (ABA)-responsive genes. Regulates several development aspects, including photomorphogenesis, apical dominance, longevity, flower morphology and fertility, as well as root and stem elongation. Promotes the formation of ectopic shoot meristems on leaf margins. {ECO:0000269|PubMed:16412086, ECO:0000269|PubMed:21059647, ECO:0000269|PubMed:21455630}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_028098669.12e-25mini zinc finger protein 2-like
SwissprotQ9CA513e-20MIF1_ARATH; Mini zinc finger protein 1
TrEMBLA0A059ADI12e-50A0A059ADI1_EUCGR; Uncharacterized protein
STRINGGorai.012G054400.12e-23(Gossypium raimondii)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G74660.12e-22mini zinc finger 1