 |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | EcC038455.10 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
|
||||||||
| Family | BES1 | ||||||||
| Protein Properties | Length: 109aa MW: 12914 Da PI: 11.9301 | ||||||||
| Description | BES1 family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | DUF822 | 162.2 | 3.2e-50 | 2 | 76 | 1 | 76 |
DUF822 1 ggsgrkptwkErEnnkrRERrRRaiaakiyaGLRaqGnyklpkraDnneVlkALcreAGwvvedDGttyrkgskpl 76
++++r+ptwkErEnnkrRERrRRaiaaki+aGLR++Gnyklpk++DnneVlkALc+eAGw+ve+DGttyrk kp
EcC038455.10 2 TSGTRTPTWKERENNKRRERRRRAIAAKIFAGLRMYGNYKLPKHCDNNEVLKALCKEAGWTVEEDGTTYRKV-KPA 76
5899******************************************************************64.444 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Pfam | PF05687 | 3.4E-46 | 3 | 75 | IPR008540 | BES1/BZR1 plant transcription factor, N-terminal |
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 109 aa Download sequence Send to blast |
MTSGTRTPTW KERENNKRRE RRRRAIAAKI FAGLRMYGNY KLPKHCDNNE VLKALCKEAG 60 WTVEEDGTTY RKVKPARRGG ALRTVACFSF FSLDRARRRR RRVVLRRLE |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5zd4_A | 1e-23 | 6 | 75 | 372 | 442 | Maltose-binding periplasmic protein,Protein BRASSINAZOLE-RESISTANT 1 |
| 5zd4_B | 1e-23 | 6 | 75 | 372 | 442 | Maltose-binding periplasmic protein,Protein BRASSINAZOLE-RESISTANT 1 |
| 5zd4_C | 1e-23 | 6 | 75 | 372 | 442 | Maltose-binding periplasmic protein,Protein BRASSINAZOLE-RESISTANT 1 |
| 5zd4_D | 1e-23 | 6 | 75 | 372 | 442 | Maltose-binding periplasmic protein,Protein BRASSINAZOLE-RESISTANT 1 |
| Search in ModeBase | ||||||
| Nucleic Localization Signal ? help Back to Top | |||
|---|---|---|---|
| No. | Start | End | Sequence |
| 1 | 96 | 101 | RRRRRR |
| Binding Motif ? help Back to Top | |||
|---|---|---|---|
| Motif ID | Method | Source | Motif file |
| MP00444 | DAP | Transfer from AT4G18890 | Download |
| |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_009352718.1 | 5e-42 | PREDICTED: BES1/BZR1 homolog protein 4-like | ||||
| Swissprot | O49404 | 1e-28 | BEH3_ARATH; BES1/BZR1 homolog protein 3 | ||||
| TrEMBL | A0A444FK93 | 7e-40 | A0A444FK93_ENSVE; Uncharacterized protein | ||||
| STRING | XP_009352718.1 | 2e-41 | (Pyrus x bretschneideri) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM15511 | 11 | 17 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT4G18890.1 | 8e-29 | BES1/BZR1 homolog 3 | ||||
| ©2010-2022, Center
for Bioinformatics, Peking University Last Modified: 2022-12-08 Questions or Comments, please contact  |
Supported By
|