PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

EcC039927.30

Organism

Eucalyptus camaldulensis

Taxonomic ID

34316

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus

Family

MIKC_MADS

Protein Properties

Length: 158aa MW: 18294 Da PI: 10.1997

Description

MIKC_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
EcC039927.30	genome	ECGD	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	91.9	3.1e-29	10	59	2	51
---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 rien + rqvtfskRr+g+lKKA+ELSvLCdaeva iifs++g+lye+ss EcC039927.30 10 RIENATSRQVTFSKRRTGLLKKAYELSVLCDAEVATIIFSQKGRLYEFSS 59 8***********************************************96 PP
2	K-box	57.4	6.3e-20	74	142	8	76
K-box 8 sleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleq 76 +++a++++l+qe ++++++ie L+ ++R+l G++L+s+s+ e+q++ +qLe+sl++iR++K ++ l+ EcC039927.30 74 TNDAATYQRLKQETTNMERKIELLEVSLRKLSGQCLGSCSMDEIQEIGDQLERSLSSIRERKVHVSLAY 142 467899********************************************************9987765 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS50066	31.595	1	61	IPR002100	Transcription factor, MADS-box
SMART	SM00432	3.2E-39	1	60	IPR002100	Transcription factor, MADS-box
CDD	cd00265	2.61E-37	3	79	No hit	No description
PRINTS	PR00404	1.8E-30	3	23	IPR002100	Transcription factor, MADS-box
SuperFamily	SSF55455	4.58E-31	3	90	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	1.9E-26	10	57	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	1.8E-30	23	38	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	1.8E-30	38	59	IPR002100	Transcription factor, MADS-box
Pfam	PF01486	2.1E-16	75	140	IPR002487	Transcription factor, K-box
PROSITE profile	PS51297	10.607	80	158	IPR002487	Transcription factor, K-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 158 aa Download sequence Send to blast
MVRGKVQMRR IENATSRQVT FSKRRTGLLK KAYELSVLCD AEVATIIFSQ KGRLYEFSSN 60 SEIRKTIDRY RRSTNDAATY QRLKQETTNM ERKIELLEVS LRKLSGQCLG SCSMDEIQEI 120 GDQLERSLSS IRERKVHVSL AYLSFSLSKV DVLRTFIE

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1tqe_P	2e-17	1	59	1	59	Myocyte-specific enhancer factor 2B
1tqe_Q	2e-17	1	59	1	59	Myocyte-specific enhancer factor 2B
1tqe_R	2e-17	1	59	1	59	Myocyte-specific enhancer factor 2B
1tqe_S	2e-17	1	59	1	59	Myocyte-specific enhancer factor 2B
6c9l_A	2e-17	1	59	1	59	Myocyte-specific enhancer factor 2B
6c9l_B	2e-17	1	59	1	59	Myocyte-specific enhancer factor 2B
6c9l_C	2e-17	1	59	1	59	Myocyte-specific enhancer factor 2B
6c9l_D	2e-17	1	59	1	59	Myocyte-specific enhancer factor 2B
6c9l_E	2e-17	1	59	1	59	Myocyte-specific enhancer factor 2B
6c9l_F	2e-17	1	59	1	59	Myocyte-specific enhancer factor 2B
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	MADS-box transcription factor that acts with AGL71 and AGL72 in the control of flowering time. Promotes flowering at the shoot apical and axillary meristems. Seems to act through a gibberellin-dependent pathway. Interacts genetically with SOC1 and its expression is directly regulated by SOC1 (PubMed:21609362). Plays a role in controlling flower organ senescence and abscission by repressing ethylene responses and regulating the expression of BOP2 and IDA (PubMed:21689171). {ECO:0000269\|PubMed:21609362, ECO:0000269\|PubMed:21689171}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_010041409.2	5e-94	PREDICTED: MADS-box protein AGL42-like
Swissprot	Q9FIS1	2e-56	AGL42_ARATH; MADS-box protein AGL42
TrEMBL	A0A058ZYA2	1e-87	A0A058ZYA2_EUCGR; Uncharacterized protein
STRING	XP_010035071.1	4e-88	(Eucalyptus grandis)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G62165.3	7e-59	AGAMOUS-like 42