![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | EcC039927.30 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
|
||||||||
| Family | MIKC_MADS | ||||||||
| Protein Properties | Length: 158aa MW: 18294 Da PI: 10.1997 | ||||||||
| Description | MIKC_MADS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SRF-TF | 91.9 | 3.1e-29 | 10 | 59 | 2 | 51 |
---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
SRF-TF 2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
rien + rqvtfskRr+g+lKKA+ELSvLCdaeva iifs++g+lye+ss
EcC039927.30 10 RIENATSRQVTFSKRRTGLLKKAYELSVLCDAEVATIIFSQKGRLYEFSS 59
8***********************************************96 PP
| |||||||
| 2 | K-box | 57.4 | 6.3e-20 | 74 | 142 | 8 | 76 |
K-box 8 sleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleq 76
+++a++++l+qe ++++++ie L+ ++R+l G++L+s+s+ e+q++ +qLe+sl++iR++K ++ l+
EcC039927.30 74 TNDAATYQRLKQETTNMERKIELLEVSLRKLSGQCLGSCSMDEIQEIGDQLERSLSSIRERKVHVSLAY 142
467899********************************************************9987765 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50066 | 31.595 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
| SMART | SM00432 | 3.2E-39 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
| CDD | cd00265 | 2.61E-37 | 3 | 79 | No hit | No description |
| PRINTS | PR00404 | 1.8E-30 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
| SuperFamily | SSF55455 | 4.58E-31 | 3 | 90 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF00319 | 1.9E-26 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 1.8E-30 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 1.8E-30 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF01486 | 2.1E-16 | 75 | 140 | IPR002487 | Transcription factor, K-box |
| PROSITE profile | PS51297 | 10.607 | 80 | 158 | IPR002487 | Transcription factor, K-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0046983 | Molecular Function | protein dimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 158 aa Download sequence Send to blast |
MVRGKVQMRR IENATSRQVT FSKRRTGLLK KAYELSVLCD AEVATIIFSQ KGRLYEFSSN 60 SEIRKTIDRY RRSTNDAATY QRLKQETTNM ERKIELLEVS LRKLSGQCLG SCSMDEIQEI 120 GDQLERSLSS IRERKVHVSL AYLSFSLSKV DVLRTFIE |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1tqe_P | 2e-17 | 1 | 59 | 1 | 59 | Myocyte-specific enhancer factor 2B |
| 1tqe_Q | 2e-17 | 1 | 59 | 1 | 59 | Myocyte-specific enhancer factor 2B |
| 1tqe_R | 2e-17 | 1 | 59 | 1 | 59 | Myocyte-specific enhancer factor 2B |
| 1tqe_S | 2e-17 | 1 | 59 | 1 | 59 | Myocyte-specific enhancer factor 2B |
| 6c9l_A | 2e-17 | 1 | 59 | 1 | 59 | Myocyte-specific enhancer factor 2B |
| 6c9l_B | 2e-17 | 1 | 59 | 1 | 59 | Myocyte-specific enhancer factor 2B |
| 6c9l_C | 2e-17 | 1 | 59 | 1 | 59 | Myocyte-specific enhancer factor 2B |
| 6c9l_D | 2e-17 | 1 | 59 | 1 | 59 | Myocyte-specific enhancer factor 2B |
| 6c9l_E | 2e-17 | 1 | 59 | 1 | 59 | Myocyte-specific enhancer factor 2B |
| 6c9l_F | 2e-17 | 1 | 59 | 1 | 59 | Myocyte-specific enhancer factor 2B |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | MADS-box transcription factor that acts with AGL71 and AGL72 in the control of flowering time. Promotes flowering at the shoot apical and axillary meristems. Seems to act through a gibberellin-dependent pathway. Interacts genetically with SOC1 and its expression is directly regulated by SOC1 (PubMed:21609362). Plays a role in controlling flower organ senescence and abscission by repressing ethylene responses and regulating the expression of BOP2 and IDA (PubMed:21689171). {ECO:0000269|PubMed:21609362, ECO:0000269|PubMed:21689171}. | |||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_010041409.2 | 5e-94 | PREDICTED: MADS-box protein AGL42-like | ||||
| Swissprot | Q9FIS1 | 2e-56 | AGL42_ARATH; MADS-box protein AGL42 | ||||
| TrEMBL | A0A058ZYA2 | 1e-87 | A0A058ZYA2_EUCGR; Uncharacterized protein | ||||
| STRING | XP_010035071.1 | 4e-88 | (Eucalyptus grandis) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G62165.3 | 7e-59 | AGAMOUS-like 42 | ||||




