PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EcC045420.10
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family MYB
Protein Properties Length: 196aa    MW: 22946.8 Da    PI: 10.3862
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EcC045420.10genomeECGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding651.4e-201562148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT+eEd++l+++++ +G+++Wk++a++ g++R++k+c++rw++yl
     EcC045420.10 15 RGAWTPEEDQKLARVIETHGPRRWKLVAAKAGLNRCGKSCRLRWLNYL 62
                     89********************************************97 PP

2Myb_DNA-binding50.16.6e-1668113148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg+ + +E++l+++++++lG++ W++Ia +++ gRt++++k++w+++l
     EcC045420.10  68 RGNISDQEEDLILRLHRLLGNR-WSLIAGRLP-GRTDNEIKNYWNSHL 113
                      78999*****************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129425.8941066IPR017930Myb domain
SMARTSM007175.5E-171464IPR001005SANT/Myb domain
SuperFamilySSF466892.35E-2914109IPR009057Homeodomain-like
PfamPF002495.6E-201562IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.7E-261669IPR009057Homeodomain-like
CDDcd001679.34E-121762No hitNo description
SMARTSM007173.1E-1567115IPR001005SANT/Myb domain
PROSITE profilePS5129420.89667117IPR017930Myb domain
PfamPF002491.8E-1468113IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.4E-2570118IPR009057Homeodomain-like
CDDcd001678.63E-1072113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006508Biological Processproteolysis
GO:0055114Biological Processoxidation-reduction process
GO:0003677Molecular FunctionDNA binding
GO:0004222Molecular Functionmetalloendopeptidase activity
GO:0005506Molecular Functioniron ion binding
GO:0005524Molecular FunctionATP binding
GO:0016705Molecular Functionoxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen
GO:0020037Molecular Functionheme binding
Sequence ? help Back to Top
Protein Sequence    Length: 196 aa     Download sequence    Send to blast
MAPTRSRYSK REANRGAWTP EEDQKLARVI ETHGPRRWKL VAAKAGLNRC GKSCRLRWLN  60
YLRPNIKRGN ISDQEEDLIL RLHRLLGNRW SLIAGRLPGR TDNEIKNYWN SHLSKKIKQK  120
ENQSKSPEQD QSQDLRNSAA RMHSMAGNNG ETSKRDEVMK TDFSRNEILD SFDEGPLNLE  180
WMSRFLEMDE SWFSFA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A9e-30121171105MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtControls the expression of genes involved in anthocyanin biosynthesis. Regulates the expression of at least 3 structural genes: chalcone synthase, dihydroflavonol reductase and flavonol O(3) glucosyltransferase. C1 acts as a trans-acting factor.
UniProtTranscription activator, when associated with BHLH2/EGL3/MYC146 or BHLH12/MYC1. Involved in epidermal cell fate specification in roots and hypocotyl. Together with GL3 or BHLH2, promotes the formation of non-hair developing cells (atrichoblasts) et the N position in root epidermis. Regulates stomata spatial distribution in hypocotyls. Binds to the WER-binding sites (WBS) promoter regions and activates the transcription of target genes such as GL2 and of CPC. {ECO:0000269|PubMed:10589676, ECO:0000269|PubMed:11585796, ECO:0000269|PubMed:14627722, ECO:0000269|PubMed:15361138, ECO:0000269|PubMed:15795220, ECO:0000269|PubMed:16207757}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Transcriptional activation correlates with reduced histone acetylation on H3 and H4 mediated by HDA18 in N cells. Repressed by CPC in hair cells (H position). {ECO:0000269|PubMed:11910008, ECO:0000269|PubMed:16176989}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010043080.11e-144PREDICTED: transcription factor MYB114
SwissprotP102901e-50MYBC_MAIZE; Anthocyanin regulatory C1 protein
SwissprotQ9SEI04e-51WER_ARATH; Transcription factor WER
TrEMBLA0A059D3X31e-142A0A059D3X3_EUCGR; Uncharacterized protein
STRINGXP_010043080.11e-143(Eucalyptus grandis)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G14750.12e-53myb domain protein 66
Publications ? help Back to Top
  1. Chen B,Wang X,Hu Y,Wang Y,Lin Z
    Ectopic expression of a c1-I allele from maize inhibits pigment formation in the flower of transgenic tobacco.
    Mol. Biotechnol., 2004. 26(3): p. 187-92
    [PMID:15004287]
  2. Paz-Ares J,Ghosal D,Saedler H
    Molecular analysis of the C1-I allele from Zea mays: a dominant mutant of the regulatory C1 locus.
    EMBO J., 1990. 9(2): p. 315-21
    [PMID:2303027]
  3. Savage N, et al.
    Positional signaling and expression of ENHANCER OF TRY AND CPC1 are tuned to increase root hair density in response to phosphate deficiency in Arabidopsis thaliana.
    PLoS ONE, 2013. 8(10): p. e75452
    [PMID:24130712]
  4. Cheng Y, et al.
    Brassinosteroids control root epidermal cell fate via direct regulation of a MYB-bHLH-WD40 complex by GSK3-like kinases.
    Elife, 2018.
    [PMID:24771765]
  5. Kiefer CS, et al.
    Correction: Arabidopsis AIP1-2 restricted by WER-mediated patterning modulates planar polarity.
    Development, 2015. 142(5): p. 1022
    [PMID:25715402]
  6. Kwak SH,Song SK,Lee MM,Schiefelbein J
    TORNADO1 regulates root epidermal patterning through the WEREWOLF pathway in Arabidopsis thaliana.
    Plant Signal Behav, 2015. 10(12): p. e1103407
    [PMID:26451798]
  7. Zhu Y, et al.
    The Histone Chaperone NRP1 Interacts with WEREWOLF to Activate GLABRA2 in Arabidopsis Root Hair Development.
    Plant Cell, 2017. 29(2): p. 260-276
    [PMID:28138017]
  8. Canales J,Contreras-López O,Álvarez JM,Gutiérrez RA
    Nitrate induction of root hair density is mediated by TGA1/TGA4 and CPC transcription factors in Arabidopsis thaliana.
    Plant J., 2017. 92(2): p. 305-316
    [PMID:28771873]
  9. Mira MM, et al.
    Expression of Arabidopsis class 1 phytoglobin (AtPgb1) delays death and degradation of the root apical meristem during severe PEG-induced water deficit.
    J. Exp. Bot., 2017. 68(20): p. 5653-5668
    [PMID:29059380]
  10. Kohanová J, et al.
    Root hair abundance impacts cadmium accumulation in Arabidopsis thaliana shoots.
    Ann. Bot., 2018. 122(5): p. 903-914
    [PMID:29394308]
  11. Cone KC,Burr FA,Burr B
    Molecular analysis of the maize anthocyanin regulatory locus C1.
    Proc. Natl. Acad. Sci. U.S.A., 1986. 83(24): p. 9631-5
    [PMID:3025847]
  12. Paz-Ares J,Ghosal D,Wienand U,Peterson PA,Saedler H
    The regulatory c1 locus of Zea mays encodes a protein with homology to myb proto-oncogene products and with structural similarities to transcriptional activators.
    EMBO J., 1987. 6(12): p. 3553-8
    [PMID:3428265]
  13. Scheffler B, et al.
    Molecular analysis of C1 alleles in Zea mays defines regions involved in the expression of this regulatory gene.
    Mol. Gen. Genet., 1994. 242(1): p. 40-8
    [PMID:7904044]
  14. Franken P,Schrell S,Peterson PA,Saedler H,Wienand U
    Molecular analysis of protein domain function encoded by the myb-homologous maize genes C1, Zm 1 and Zm 38.
    Plant J., 1994. 6(1): p. 21-30
    [PMID:7920701]
  15. Singer T,Gierl A,Peterson PA
    Three new dominant C1 suppressor alleles in Zea mays.
    Genet. Res., 1998. 71(2): p. 127-32
    [PMID:9717435]