PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

EcC048399.10

Organism

Eucalyptus camaldulensis

Taxonomic ID

34316

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus

Family

M-type_MADS

Protein Properties

Length: 61aa MW: 6927.12 Da PI: 10.7062

Description

M-type_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
EcC048399.10	genome	ECGD	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	93.2	1.2e-29	9	59	1	51
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 k+i n + rqvtfskRr g++KKAeELSvLCda+va+i+fss+gkl+ey+s EcC048399.10 9 KKITNATARQVTFSKRRRGLFKKAEELSVLCDADVALIVFSSSGKLFEYCS 59 689**********************************************96 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00432	4.2E-40	1	60	IPR002100	Transcription factor, MADS-box
PROSITE profile	PS50066	29.73	1	61	IPR002100	Transcription factor, MADS-box
CDD	cd00265	2.03E-34	2	60	No hit	No description
SuperFamily	SSF55455	4.06E-29	3	60	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	2.1E-28	3	23	IPR002100	Transcription factor, MADS-box
PROSITE pattern	PS00350	0	3	57	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	1.6E-27	10	57	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	2.1E-28	23	38	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	2.1E-28	38	59	IPR002100	Transcription factor, MADS-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 61 aa Download sequence Send to blast
MAREKIQIKK ITNATARQVT FSKRRRGLFK KAEELSVLCD ADVALIVFSS SGKLFEYCSS 60 R

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
6byy_A	2e-20	1	60	1	60	MEF2 CHIMERA
6byy_B	2e-20	1	60	1	60	MEF2 CHIMERA
6byy_C	2e-20	1	60	1	60	MEF2 CHIMERA
6byy_D	2e-20	1	60	1	60	MEF2 CHIMERA
6bz1_A	2e-20	1	60	1	60	MEF2 CHIMERA
6bz1_B	2e-20	1	60	1	60	MEF2 CHIMERA
6bz1_C	2e-20	1	60	1	60	MEF2 CHIMERA
6bz1_D	2e-20	1	60	1	60	MEF2 CHIMERA
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription repressor that inhibit floral transition in the autonomous flowering pathway, independent of photoperiod and temperature. Acts in a dosage-dependent manner. Together with AGL24 and AP1, controls the identity of the floral meristem and regulates expression of class B, C and E genes. Promotes EFM expression to suppress flowering (PubMed:25132385). {ECO:0000269\|PubMed:16679456, ECO:0000269\|PubMed:18694458, ECO:0000269\|PubMed:19656343, ECO:0000269\|PubMed:25132385}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Repressed by the floral homeotic genes AP1 and SEP3 in emerging floral meristems. Up-regulated by HUA2. {ECO:0000269\|PubMed:15659097, ECO:0000269\|PubMed:17428825, ECO:0000269\|PubMed:18694458}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	NP_001289637.1	2e-35	MADS-box protein JOINTLESS
Refseq	XP_010027953.1	2e-35	PREDICTED: MADS-box protein JOINTLESS isoform X1
Refseq	XP_018717707.1	2e-35	PREDICTED: MADS-box protein JOINTLESS isoform X1
Refseq	XP_018717708.1	2e-35	PREDICTED: MADS-box protein JOINTLESS isoform X1
Swissprot	Q9FVC1	8e-34	SVP_ARATH; MADS-box protein SVP
TrEMBL	A0A059AKT4	4e-34	A0A059AKT4_EUCGR; Uncharacterized protein
TrEMBL	Q7Y1U9	3e-34	Q7Y1U9_9MYRT; SVP-like floral repressor
TrEMBL	Q84LN9	4e-34	Q84LN9_EUCGR; SVP-like floral repressor
STRING	XP_010027952.1	7e-35	(Eucalyptus grandis)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM78	28	413

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G22540.1	3e-36	MIKC_MADS family protein

Publications ? help Back to Top
Ramamoorthy R,Phua EE,Lim SH,Tan HT,Kumar PP Identification and characterization of RcMADS1, an AGL24 ortholog from the holoparasitic plant Rafflesia cantleyi Solms-Laubach (Rafflesiaceae). PLoS ONE, 2013. 8(6): p. e67243 [PMID:23840638] Jaudal M, et al. Overexpression of Medicago SVP genes causes floral defects and delayed flowering in Arabidopsis but only affects floral development in Medicago. J. Exp. Bot., 2014. 65(2): p. 429-42 [PMID:24249713] Müller-Xing R,Clarenz O,Pokorny L,Goodrich J,Schubert D Polycomb-Group Proteins and FLOWERING LOCUS T Maintain Commitment to Flowering in Arabidopsis thaliana. Plant Cell, 2014. 26(6): p. 2457-2471 [PMID:24920331] Hwan Lee J,Sook Chung K,Kim SK,Ahn JH Post-translational regulation of SHORT VEGETATIVE PHASE as a major mechanism for thermoregulation of flowering. Plant Signal Behav, 2014. 9(4): p. e28193 [PMID:25764420] Chen Z, et al. Overexpression of AtAP1M3 regulates flowering time and floral development in Arabidopsis and effects key flowering-related genes in poplar. Transgenic Res., 2015. 24(4): p. 705-15 [PMID:25820621] Wells CE,Vendramin E,Jimenez Tarodo S,Verde I,Bielenberg DG A genome-wide analysis of MADS-box genes in peach [Prunus persica (L.) Batsch]. BMC Plant Biol., 2015. 15: p. 41 [PMID:25848674] Müller-Xing R,Schubert D,Goodrich J Non-inductive conditions expose the cryptic bract of flower phytomeres in Arabidopsis thaliana. Plant Signal Behav, 2015. 10(4): p. e1010868 [PMID:25924005] Marín-González E, et al. SHORT VEGETATIVE PHASE Up-Regulates TEMPRANILLO2 Floral Repressor at Low Ambient Temperatures. Plant Physiol., 2015. 169(2): p. 1214-24 [PMID:26243615] Bechtold U, et al. Time-Series Transcriptomics Reveals That AGAMOUS-LIKE22 Affects Primary Metabolism and Developmental Processes in Drought-Stressed Arabidopsis. Plant Cell, 2016. 28(2): p. 345-66 [PMID:26842464] Fernández V,Takahashi Y,Le Gourrierec J,Coupland G Photoperiodic and thermosensory pathways interact through CONSTANS to promote flowering at high temperature under short days. Plant J., 2016. 86(5): p. 426-40 [PMID:27117775] Wilson DC,Kempthorne CJ,Carella P,Liscombe DK,Cameron RK Age-Related Resistance in Arabidopsis thaliana Involves the MADS-Domain Transcription Factor SHORT VEGETATIVE PHASE and Direct Action of Salicylic Acid on Pseudomonas syringae. Mol. Plant Microbe Interact., 2017. 30(11): p. 919-929 [PMID:28812948] Zou YP, et al. Adaptation of Arabidopsis thaliana to the Yangtze River basin. Genome Biol., 2017. 18(1): p. 239 [PMID:29284515] Richter R, et al. Floral regulators FLC and SOC1 directly regulate expression of the B3-type transcription factor TARGET OF FLC AND SVP 1 at the Arabidopsis shoot apex via antagonistic chromatin modifications. PLoS Genet., 2019. 15(4): p. e1008065 [PMID:30946745]