![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | EcC048499.20 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
|
||||||||
| Family | MYB | ||||||||
| Protein Properties | Length: 119aa MW: 13965.1 Da PI: 11.5881 | ||||||||
| Description | MYB family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 30.7 | 7.4e-10 | 17 | 60 | 5 | 48 |
-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
Myb_DNA-binding 5 TteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
++eEd++l+ +++++G +W+ a+ g+ Rt+k+c++r ++l
EcC048499.20 17 SPEEDQKLIAYIRRYGIWNWTQMAKPAGLARTGKSCRLRSMNHL 60
79**************99*********************88875 PP
| |||||||
| 2 | Myb_DNA-binding | 43.1 | 9.5e-14 | 69 | 108 | 5 | 46 |
-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
Myb_DNA-binding 5 TteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
Tt E+e+++++++ lG++ W++Ia++ gRt++++k++w++
EcC048499.20 69 TTKEEEIIIRLHRVLGNR-WAAIAARPH-GRTDNEIKNYWNT 108
899***************.*********.***********97 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50090 | 7.515 | 8 | 60 | IPR017877 | Myb-like domain |
| SuperFamily | SSF46689 | 8.98E-23 | 11 | 106 | IPR009057 | Homeodomain-like |
| SMART | SM00717 | 0.0065 | 12 | 62 | IPR001005 | SANT/Myb domain |
| Pfam | PF00249 | 5.6E-8 | 17 | 60 | IPR001005 | SANT/Myb domain |
| CDD | cd00167 | 9.22E-6 | 17 | 60 | No hit | No description |
| Gene3D | G3DSA:1.10.10.60 | 1.0E-17 | 17 | 67 | IPR009057 | Homeodomain-like |
| PROSITE profile | PS51294 | 16.637 | 61 | 114 | IPR017930 | Myb domain |
| SMART | SM00717 | 1.5E-8 | 64 | 112 | IPR001005 | SANT/Myb domain |
| Gene3D | G3DSA:1.10.10.60 | 2.6E-19 | 68 | 112 | IPR009057 | Homeodomain-like |
| Pfam | PF00249 | 2.5E-11 | 69 | 108 | IPR001005 | SANT/Myb domain |
| CDD | cd00167 | 4.60E-8 | 69 | 110 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 119 aa Download sequence Send to blast |
MKQVGEVEFG KKRTLGSPEE DQKLIAYIRR YGIWNWTQMA KPAGLARTGK SCRLRSMNHL 60 RPNIRRGNTT KEEEIIIRLH RVLGNRWAAI AARPHGRTDN EIKNYWNTRL KKHFPKSQS |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1a5j_A | 2e-24 | 17 | 112 | 11 | 106 | B-MYB |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor involved in cold-regulation of CBF genes and in the development of freezing tolerance. May be part of a complex network of transcription factors controlling the expression of CBF genes and other genes in response to cold stress. Binds to the MYB recognition sequences in the promoters of CBF1, CBF2 and CBF3 genes (PubMed:17015446). Involved in drought and salt tolerance. May enhance expression levels of genes involved in abscisic acid (ABA) biosynthesis and signaling, as well as those encoding stress-protective proteins (PubMed:19161942). {ECO:0000269|PubMed:17015446, ECO:0000269|PubMed:19161942}. | |||||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Induced by abscisic acid (ABA) and drought stress (PubMed:19161942). Induced by salt stress (PubMed:19161942). {ECO:0000269|PubMed:19161942}. | |||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_010051856.1 | 3e-50 | PREDICTED: myb-related protein 308 | ||||
| Refseq | XP_010051860.1 | 3e-50 | PREDICTED: transcription factor MYB82-like | ||||
| Refseq | XP_018728065.1 | 2e-50 | PREDICTED: transcription factor WER-like | ||||
| Swissprot | Q9LTC4 | 3e-37 | MYB15_ARATH; Transcription factor MYB15 | ||||
| TrEMBL | A0A218WNG1 | 1e-50 | A0A218WNG1_PUNGR; Uncharacterized protein | ||||
| STRING | XP_010051856.1 | 1e-49 | (Eucalyptus grandis) | ||||
| STRING | XP_010051860.1 | 1e-49 | (Eucalyptus grandis) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM4 | 28 | 2646 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G23250.1 | 1e-39 | myb domain protein 15 | ||||




