PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

EcC051147.50

Organism

Eucalyptus camaldulensis

Taxonomic ID

34316

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus

Family

M-type_MADS

Protein Properties

Length: 101aa MW: 11753.7 Da PI: 10.767

Description

M-type_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
EcC051147.50	genome	ECGD	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	95.7	2.1e-30	9	59	1	51
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krien + rq tfskRrng++KKA+ELSvLCdaevaviifs++g+lye+ss EcC051147.50 9 KRIENATSRQATFSKRRNGLMKKAFELSVLCDAEVAVIIFSQRGRLYEFSS 59 79***********************************************96 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS50066	32.099	1	61	IPR002100	Transcription factor, MADS-box
SMART	SM00432	6.3E-40	1	60	IPR002100	Transcription factor, MADS-box
CDD	cd00265	7.53E-37	2	60	No hit	No description
SuperFamily	SSF55455	1.23E-29	3	64	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	6.0E-31	3	23	IPR002100	Transcription factor, MADS-box
PROSITE pattern	PS00350	0	3	57	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	8.9E-27	10	57	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	6.0E-31	23	38	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	6.0E-31	38	59	IPR002100	Transcription factor, MADS-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006979	Biological Process	response to oxidative stress
GO:0055114	Biological Process	oxidation-reduction process
GO:0003677	Molecular Function	DNA binding
GO:0004601	Molecular Function	peroxidase activity
GO:0005506	Molecular Function	iron ion binding
GO:0016614	Molecular Function	oxidoreductase activity, acting on CH-OH group of donors
GO:0016705	Molecular Function	oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen
GO:0020037	Molecular Function	heme binding
GO:0031418	Molecular Function	L-ascorbic acid binding
GO:0046983	Molecular Function	protein dimerization activity
GO:0050660	Molecular Function	flavin adenine dinucleotide binding

Sequence ? help Back to Top
Protein Sequence Length: 101 aa Download sequence Send to blast
MARGKIQMKR IENATSRQAT FSKRRNGLMK KAFELSVLCD AEVAVIIFSQ RGRLYEFSSS 60 KYVSNTSFTS RQYIVLVRFL ILVEGFFIFT FSGCEKRTWE T

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1tqe_P	3e-18	1	60	1	60	Myocyte-specific enhancer factor 2B
1tqe_Q	3e-18	1	60	1	60	Myocyte-specific enhancer factor 2B
1tqe_R	3e-18	1	60	1	60	Myocyte-specific enhancer factor 2B
1tqe_S	3e-18	1	60	1	60	Myocyte-specific enhancer factor 2B
6c9l_A	3e-18	1	60	1	60	Myocyte-specific enhancer factor 2B
6c9l_B	3e-18	1	60	1	60	Myocyte-specific enhancer factor 2B
6c9l_C	3e-18	1	60	1	60	Myocyte-specific enhancer factor 2B
6c9l_D	3e-18	1	60	1	60	Myocyte-specific enhancer factor 2B
6c9l_E	3e-18	1	60	1	60	Myocyte-specific enhancer factor 2B
6c9l_F	3e-18	1	60	1	60	Myocyte-specific enhancer factor 2B
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcriptional activator that regulates root development by controlling meristem size and patterning of the root apical meristem. Regulates auxin transport and gradients in the root meristematic cells via direct regulation of the auxin efflux carrier PIN1 and PIN4 gene expression. Binds specifically to the CArG-box DNA sequences in the promoter regions of PIN1 and PIN4 genes (PubMed:24121311). Involved in the regulation of shoot apical meristem (SAM) cell identities and transitions. Promotes flowering transition and participates in flower meristem maintenance and determinacy. Positively regulates TFL1 and WUS expression. Binds directly to the TFL1 regulatory sequences (PubMed:25636918). {ECO:0000269\|PubMed:24121311}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By auxin. {ECO:0000269\|PubMed:24121311}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_018625082.1	6e-35	PREDICTED: MADS-box protein AGL42-like
Refseq	XP_018625083.1	6e-35	PREDICTED: MADS-box protein AGL42-like
Refseq	XP_018625084.1	6e-35	PREDICTED: MADS-box protein AGL42-like
Refseq	XP_018625085.1	6e-35	PREDICTED: MADS-box protein AGL42-like
Refseq	XP_018716225.1	1e-34	PREDICTED: MADS-box protein SOC1
Refseq	XP_018716231.1	1e-34	PREDICTED: MADS-box protein SOC1
Refseq	XP_018716232.1	1e-34	PREDICTED: MADS-box protein SOC1
Refseq	XP_018716234.1	1e-34	PREDICTED: MADS-box protein SOC1
Swissprot	Q38838	2e-31	AGL14_ARATH; Agamous-like MADS-box protein AGL14
TrEMBL	A0A059DK60	4e-34	A0A059DK60_EUCGR; Uncharacterized protein
STRING	XP_010061717.1	2e-34	(Eucalyptus grandis)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G11880.1	9e-34	AGAMOUS-like 14

Publications ? help Back to Top
Zimmermann P,Hirsch-Hoffmann M,Hennig L,Gruissem W GENEVESTIGATOR. Arabidopsis microarray database and analysis toolbox. Plant Physiol., 2004. 136(1): p. 2621-32 [PMID:15375207] Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Qu Y, et al. Peroxisomal CuAOζ and its product H2O2 regulate the distribution of auxin and IBA-dependent lateral root development in Arabidopsis. J. Exp. Bot., 2017. 68(17): p. 4851-4867 [PMID:28992128]