PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EcC051147.50
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family M-type_MADS
Protein Properties Length: 101aa    MW: 11753.7 Da    PI: 10.767
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EcC051147.50genomeECGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF95.72.1e-30959151
                  S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
        SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                  krien + rq tfskRrng++KKA+ELSvLCdaevaviifs++g+lye+ss
  EcC051147.50  9 KRIENATSRQATFSKRRNGLMKKAFELSVLCDAEVAVIIFSQRGRLYEFSS 59
                  79***********************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006632.099161IPR002100Transcription factor, MADS-box
SMARTSM004326.3E-40160IPR002100Transcription factor, MADS-box
CDDcd002657.53E-37260No hitNo description
SuperFamilySSF554551.23E-29364IPR002100Transcription factor, MADS-box
PRINTSPR004046.0E-31323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003198.9E-271057IPR002100Transcription factor, MADS-box
PRINTSPR004046.0E-312338IPR002100Transcription factor, MADS-box
PRINTSPR004046.0E-313859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006979Biological Processresponse to oxidative stress
GO:0055114Biological Processoxidation-reduction process
GO:0003677Molecular FunctionDNA binding
GO:0004601Molecular Functionperoxidase activity
GO:0005506Molecular Functioniron ion binding
GO:0016614Molecular Functionoxidoreductase activity, acting on CH-OH group of donors
GO:0016705Molecular Functionoxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen
GO:0020037Molecular Functionheme binding
GO:0031418Molecular FunctionL-ascorbic acid binding
GO:0046983Molecular Functionprotein dimerization activity
GO:0050660Molecular Functionflavin adenine dinucleotide binding
Sequence ? help Back to Top
Protein Sequence    Length: 101 aa     Download sequence    Send to blast
MARGKIQMKR IENATSRQAT FSKRRNGLMK KAFELSVLCD AEVAVIIFSQ RGRLYEFSSS  60
KYVSNTSFTS RQYIVLVRFL ILVEGFFIFT FSGCEKRTWE T
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P3e-18160160Myocyte-specific enhancer factor 2B
1tqe_Q3e-18160160Myocyte-specific enhancer factor 2B
1tqe_R3e-18160160Myocyte-specific enhancer factor 2B
1tqe_S3e-18160160Myocyte-specific enhancer factor 2B
6c9l_A3e-18160160Myocyte-specific enhancer factor 2B
6c9l_B3e-18160160Myocyte-specific enhancer factor 2B
6c9l_C3e-18160160Myocyte-specific enhancer factor 2B
6c9l_D3e-18160160Myocyte-specific enhancer factor 2B
6c9l_E3e-18160160Myocyte-specific enhancer factor 2B
6c9l_F3e-18160160Myocyte-specific enhancer factor 2B
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that regulates root development by controlling meristem size and patterning of the root apical meristem. Regulates auxin transport and gradients in the root meristematic cells via direct regulation of the auxin efflux carrier PIN1 and PIN4 gene expression. Binds specifically to the CArG-box DNA sequences in the promoter regions of PIN1 and PIN4 genes (PubMed:24121311). Involved in the regulation of shoot apical meristem (SAM) cell identities and transitions. Promotes flowering transition and participates in flower meristem maintenance and determinacy. Positively regulates TFL1 and WUS expression. Binds directly to the TFL1 regulatory sequences (PubMed:25636918). {ECO:0000269|PubMed:24121311}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By auxin. {ECO:0000269|PubMed:24121311}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_018625082.16e-35PREDICTED: MADS-box protein AGL42-like
RefseqXP_018625083.16e-35PREDICTED: MADS-box protein AGL42-like
RefseqXP_018625084.16e-35PREDICTED: MADS-box protein AGL42-like
RefseqXP_018625085.16e-35PREDICTED: MADS-box protein AGL42-like
RefseqXP_018716225.11e-34PREDICTED: MADS-box protein SOC1
RefseqXP_018716231.11e-34PREDICTED: MADS-box protein SOC1
RefseqXP_018716232.11e-34PREDICTED: MADS-box protein SOC1
RefseqXP_018716234.11e-34PREDICTED: MADS-box protein SOC1
SwissprotQ388382e-31AGL14_ARATH; Agamous-like MADS-box protein AGL14
TrEMBLA0A059DK604e-34A0A059DK60_EUCGR; Uncharacterized protein
STRINGXP_010061717.12e-34(Eucalyptus grandis)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G11880.19e-34AGAMOUS-like 14
Publications ? help Back to Top
  1. Zimmermann P,Hirsch-Hoffmann M,Hennig L,Gruissem W
    GENEVESTIGATOR. Arabidopsis microarray database and analysis toolbox.
    Plant Physiol., 2004. 136(1): p. 2621-32
    [PMID:15375207]
  2. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  3. Qu Y, et al.
    Peroxisomal CuAOζ and its product H2O2 regulate the distribution of auxin and IBA-dependent lateral root development in Arabidopsis.
    J. Exp. Bot., 2017. 68(17): p. 4851-4867
    [PMID:28992128]