![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | EcC051183.20 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
|
||||||||
| Family | GATA | ||||||||
| Protein Properties | Length: 87aa MW: 9965.43 Da PI: 10.924 | ||||||||
| Description | GATA family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | GATA | 60.8 | 1.7e-19 | 32 | 64 | 3 | 35 |
GATA 3 nCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35
+C++t++p+WRrgp g+ktLCnaCG++yrk ++
EcC051183.20 32 QCNATTSPMWRRGPLGPKTLCNACGIKYRKDEE 64
8*****************************876 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00401 | 1.1E-12 | 22 | 71 | IPR000679 | Zinc finger, GATA-type |
| SuperFamily | SSF57716 | 6.18E-13 | 25 | 70 | No hit | No description |
| Gene3D | G3DSA:3.30.50.10 | 3.5E-14 | 26 | 73 | IPR013088 | Zinc finger, NHR/GATA-type |
| CDD | cd00202 | 6.72E-11 | 27 | 61 | No hit | No description |
| Pfam | PF00320 | 5.7E-17 | 32 | 64 | IPR000679 | Zinc finger, GATA-type |
| PROSITE profile | PS50114 | 11.714 | 33 | 82 | IPR000679 | Zinc finger, GATA-type |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0006810 | Biological Process | transport | ||||
| GO:0007165 | Biological Process | signal transduction | ||||
| GO:0016020 | Cellular Component | membrane | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0005215 | Molecular Function | transporter activity | ||||
| GO:0005515 | Molecular Function | protein binding | ||||
| GO:0008270 | Molecular Function | zinc ion binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 87 aa Download sequence Send to blast |
YSSGRPQKLP VRRRQQSHDD TDSPIKRCVN PQCNATTSPM WRRGPLGPKT LCNACGIKYR 60 KDEEKRRTQV IMQQLHELAA ARHKPAA |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcriptional regulator that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters. {ECO:0000250}. | |||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_022728763.1 | 9e-20 | GATA transcription factor 29-like | ||||
| Swissprot | Q9LT45 | 2e-17 | GAT29_ARATH; GATA transcription factor 29 | ||||
| TrEMBL | A0A2I0JIN9 | 1e-18 | A0A2I0JIN9_PUNGR; Uncharacterized protein | ||||
| STRING | Gorai.009G070200.1 | 2e-17 | (Gossypium raimondii) | ||||
| STRING | XP_002528130.1 | 1e-17 | (Ricinus communis) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G20750.1 | 9e-20 | GATA transcription factor 29 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




