PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

EcC051544.30

Organism

Eucalyptus camaldulensis

Taxonomic ID

34316

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus

Family

MIKC_MADS

Protein Properties

Length: 209aa MW: 24005.4 Da PI: 10.3141

Description

MIKC_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
EcC051544.30	genome	ECGD	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	91.3	4.9e-29	10	59	2	51
---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 rien + rqvtfskRrng+lKKA+ELSvLCdaeva iifs++g+lye+ss EcC051544.30 10 RIENVTSRQVTFSKRRNGLLKKAYELSVLCDAEVAAIIFSQKGRLYEFSS 59 8***********************************************96 PP
2	K-box	61.5	3.3e-21	84	171	10	97
K-box 10 eeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkk 97 e+ +l++e ++++ie L+ ++ +l G++L+s+s+ e+q + +qLe+sl++iR++K +l+ +q ++lq ke++l+een +L +k EcC051544.30 84 MEQRILHLKRETMEMERKIELLEVSLQKLSGQCLGSCSIDEIQGIGDQLERSLSSIRKRKVQLFNDQRQQLQAKERSLREENAKLLAK 171 566777999****************************************************************************988 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS50066	31.861	1	61	IPR002100	Transcription factor, MADS-box
SMART	SM00432	1.5E-39	1	60	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	1.5E-30	3	23	IPR002100	Transcription factor, MADS-box
CDD	cd00265	7.14E-39	3	76	No hit	No description
SuperFamily	SSF55455	4.84E-31	3	75	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	4.7E-26	10	57	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	1.5E-30	23	38	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	1.5E-30	38	59	IPR002100	Transcription factor, MADS-box
Pfam	PF01486	5.2E-19	86	172	IPR002487	Transcription factor, K-box
PROSITE profile	PS51297	13.086	88	178	IPR002487	Transcription factor, K-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 209 aa Download sequence Send to blast
MVRGKIQMRR IENVTSRQVT FSKRRNGLLK KAYELSVLCD AEVAAIIFSQ KGRLYEFSSN 60 SEIRKTIDRY RGSTNDVDTY RANMEQRILH LKRETMEMER KIELLEVSLQ KLSGQCLGSC 120 SIDEIQGIGD QLERSLSSIR KRKVQLFNDQ RQQLQAKERS LREENAKLLA KCLANHGQST 180 ANPRATALHR RSSWSTDVET GLFIGLPES

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1tqe_P	1e-16	1	59	1	59	Myocyte-specific enhancer factor 2B
1tqe_Q	1e-16	1	59	1	59	Myocyte-specific enhancer factor 2B
1tqe_R	1e-16	1	59	1	59	Myocyte-specific enhancer factor 2B
1tqe_S	1e-16	1	59	1	59	Myocyte-specific enhancer factor 2B
5f28_A	1e-16	1	70	1	69	MEF2C
5f28_B	1e-16	1	70	1	69	MEF2C
5f28_C	1e-16	1	70	1	69	MEF2C
5f28_D	1e-16	1	70	1	69	MEF2C
6byy_A	1e-16	1	70	1	69	MEF2 CHIMERA
6byy_B	1e-16	1	70	1	69	MEF2 CHIMERA
6byy_C	1e-16	1	70	1	69	MEF2 CHIMERA
6byy_D	1e-16	1	70	1	69	MEF2 CHIMERA
6c9l_A	1e-16	1	59	1	59	Myocyte-specific enhancer factor 2B
6c9l_B	1e-16	1	59	1	59	Myocyte-specific enhancer factor 2B
6c9l_C	1e-16	1	59	1	59	Myocyte-specific enhancer factor 2B
6c9l_D	1e-16	1	59	1	59	Myocyte-specific enhancer factor 2B
6c9l_E	1e-16	1	59	1	59	Myocyte-specific enhancer factor 2B
6c9l_F	1e-16	1	59	1	59	Myocyte-specific enhancer factor 2B
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	MADS-box transcription factor that acts with AGL71 and AGL72 in the control of flowering time. Promotes flowering at the shoot apical and axillary meristems. Seems to act through a gibberellin-dependent pathway. Interacts genetically with SOC1 and its expression is directly regulated by SOC1 (PubMed:21609362). Plays a role in controlling flower organ senescence and abscission by repressing ethylene responses and regulating the expression of BOP2 and IDA (PubMed:21689171). {ECO:0000269\|PubMed:21609362, ECO:0000269\|PubMed:21689171}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_010035074.1	1e-150	PREDICTED: MADS-box protein AGL42
Swissprot	Q9FIS1	3e-69	AGL42_ARATH; MADS-box protein AGL42
TrEMBL	A0A058ZZ53	1e-149	A0A058ZZ53_EUCGR; Uncharacterized protein
STRING	XP_010035074.1	1e-149	(Eucalyptus grandis)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM78	28	413

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G62165.3	1e-71	AGAMOUS-like 42