![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | EcC052230.40 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
|
||||||||
| Family | NAC | ||||||||
| Protein Properties | Length: 128aa MW: 14480.9 Da PI: 5.2058 | ||||||||
| Description | NAC family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NAM | 59 | 1.6e-18 | 6 | 61 | 72 | 128 |
NAM 72 krknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
k + r+t +gyWk g ++v++++++ vg+k++Lv+y g+ap g++t+W+mheyrl
EcC052230.40 6 KTPDRITGNGYWKPMGD-EPVFTSSSKRVGMKQSLVYYLGEAPGGTRTNWIMHEYRL 61
46789**********98.677777999****************************98 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS51005 | 27.41 | 1 | 96 | IPR003441 | NAC domain |
| Pfam | PF02365 | 2.4E-11 | 1 | 61 | IPR003441 | NAC domain |
| SuperFamily | SSF101941 | 5.49E-23 | 1 | 94 | IPR003441 | NAC domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0007623 | Biological Process | circadian rhythm | ||||
| GO:0010020 | Biological Process | chloroplast fission | ||||
| GO:0016559 | Biological Process | peroxisome fission | ||||
| GO:0048268 | Biological Process | clathrin coat assembly | ||||
| GO:0055114 | Biological Process | oxidation-reduction process | ||||
| GO:0005777 | Cellular Component | peroxisome | ||||
| GO:0009707 | Cellular Component | chloroplast outer membrane | ||||
| GO:0030136 | Cellular Component | clathrin-coated vesicle | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0003924 | Molecular Function | GTPase activity | ||||
| GO:0005525 | Molecular Function | GTP binding | ||||
| GO:0005545 | Molecular Function | 1-phosphatidylinositol binding | ||||
| GO:0016491 | Molecular Function | oxidoreductase activity | ||||
| GO:0030276 | Molecular Function | clathrin binding | ||||
| GO:0042802 | Molecular Function | identical protein binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 128 aa Download sequence Send to blast |
YFFSRKTPDR ITGNGYWKPM GDEPVFTSSS KRVGMKQSLV YYLGEAPGGT RTNWIMHEYR 60 LSNGTNSGSS SSRSSKRKGY PKIDYSKWVV CRVYEHGDDD NDDNGAELSC LDEVFLSLDD 120 LDEISTPN |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1ut4_A | 1e-22 | 1 | 95 | 74 | 164 | NO APICAL MERISTEM PROTEIN |
| 1ut4_B | 1e-22 | 1 | 95 | 74 | 164 | NO APICAL MERISTEM PROTEIN |
| 1ut7_A | 1e-22 | 1 | 95 | 74 | 164 | NO APICAL MERISTEM PROTEIN |
| 1ut7_B | 1e-22 | 1 | 95 | 74 | 164 | NO APICAL MERISTEM PROTEIN |
| 3swm_A | 1e-22 | 1 | 95 | 77 | 167 | NAC domain-containing protein 19 |
| 3swm_B | 1e-22 | 1 | 95 | 77 | 167 | NAC domain-containing protein 19 |
| 3swm_C | 1e-22 | 1 | 95 | 77 | 167 | NAC domain-containing protein 19 |
| 3swm_D | 1e-22 | 1 | 95 | 77 | 167 | NAC domain-containing protein 19 |
| 3swp_A | 1e-22 | 1 | 95 | 77 | 167 | NAC domain-containing protein 19 |
| 3swp_B | 1e-22 | 1 | 95 | 77 | 167 | NAC domain-containing protein 19 |
| 3swp_C | 1e-22 | 1 | 95 | 77 | 167 | NAC domain-containing protein 19 |
| 3swp_D | 1e-22 | 1 | 95 | 77 | 167 | NAC domain-containing protein 19 |
| 4dul_A | 1e-22 | 1 | 95 | 74 | 164 | NAC domain-containing protein 19 |
| 4dul_B | 1e-22 | 1 | 95 | 74 | 164 | NAC domain-containing protein 19 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription factor that influences tracheary elements and xylem development by negatively regulating secondary cell wall fiber synthesis and programmed cell death. {ECO:0000269|PubMed:18069942, ECO:0000269|PubMed:20458494}. | |||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_010030072.1 | 5e-90 | PREDICTED: NAC domain-containing protein 104 | ||||
| Swissprot | Q8GWK6 | 2e-37 | NC104_ARATH; NAC domain-containing protein 104 | ||||
| TrEMBL | A0A059ASW0 | 1e-88 | A0A059ASW0_EUCGR; Uncharacterized protein | ||||
| STRING | XP_010030072.1 | 2e-89 | (Eucalyptus grandis) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G64530.1 | 1e-38 | xylem NAC domain 1 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




