![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | EcC052470.10 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
|
||||||||
| Family | M-type_MADS | ||||||||
| Protein Properties | Length: 129aa MW: 15016.1 Da PI: 6.5363 | ||||||||
| Description | M-type_MADS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SRF-TF | 84.7 | 5.3e-27 | 10 | 58 | 2 | 50 |
---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
SRF-TF 2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
rien +nrqvtfskRrng++KKA+ELSvLCd+++a+i+fs+++++ +s
EcC052470.10 10 RIENITNRQVTFSKRRNGLIKKAYELSVLCDIDIALIMFSPSDRVSHFS 58
8*******************************************99987 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00432 | 1.5E-36 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
| PROSITE profile | PS50066 | 28.791 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
| SuperFamily | SSF55455 | 4.06E-29 | 2 | 83 | IPR002100 | Transcription factor, MADS-box |
| CDD | cd00265 | 3.81E-33 | 2 | 75 | No hit | No description |
| PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 4.6E-25 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF00319 | 2.2E-25 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 4.6E-25 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 4.6E-25 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0030001 | Biological Process | metal ion transport | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0046872 | Molecular Function | metal ion binding | ||||
| GO:0046983 | Molecular Function | protein dimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 129 aa Download sequence Send to blast |
MGRVKLEIRR IENITNRQVT FSKRRNGLIK KAYELSVLCD IDIALIMFSP SDRVSHFSGK 60 RRIEDVFTRF INLTDQERDT TLQQLRNEND LALQLANPGA VDADAEELHQ QIGMLRQQLL 120 EAEEQIRYS |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 6byy_A | 2e-17 | 1 | 59 | 1 | 59 | MEF2 CHIMERA |
| 6byy_B | 2e-17 | 1 | 59 | 1 | 59 | MEF2 CHIMERA |
| 6byy_C | 2e-17 | 1 | 59 | 1 | 59 | MEF2 CHIMERA |
| 6byy_D | 2e-17 | 1 | 59 | 1 | 59 | MEF2 CHIMERA |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription factor that forms a heterodimer with the MADS-box protein AGL30 and is involved in the regulation of pollen maturation at the late stages of pollen development and pollen tube growth. {ECO:0000269|PubMed:19211705}. | |||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_020410352.1 | 2e-66 | agamous-like MADS-box protein AGL104 isoform X3 | ||||
| Swissprot | Q1PFC2 | 4e-60 | AGL66_ARATH; Agamous-like MADS-box protein AGL66 | ||||
| TrEMBL | A0A2I4H0X0 | 8e-63 | A0A2I4H0X0_JUGRE; agamous-like MADS-box protein AGL104 isoform X1 | ||||
| STRING | XP_010026056.1 | 1e-79 | (Eucalyptus grandis) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G77980.1 | 2e-62 | AGAMOUS-like 66 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




