PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EcC053060.20
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family M-type_MADS
Protein Properties Length: 76aa    MW: 8848.18 Da    PI: 11.0697
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EcC053060.20genomeECGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF98.33.2e-311059251
                  ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
        SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                  rien + rqvtfskRr+g+lKKA+ELSvLCdaevaviifs++g+lye+ss
  EcC053060.20 10 RIENATSRQVTFSKRRTGLLKKAYELSVLCDAEVAVIIFSQKGRLYEFSS 59
                  8***********************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006632.478161IPR002100Transcription factor, MADS-box
SMARTSM004321.4E-40160IPR002100Transcription factor, MADS-box
CDDcd002652.28E-39276No hitNo description
SuperFamilySSF554553.66E-32374IPR002100Transcription factor, MADS-box
PRINTSPR004041.7E-31323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003197.1E-281057IPR002100Transcription factor, MADS-box
PRINTSPR004041.7E-312338IPR002100Transcription factor, MADS-box
PRINTSPR004041.7E-313859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 76 aa     Download sequence    Send to blast
MARGKVQMRR IENATSRQVT FSKRRTGLLK KAYELSVLCD AEVAVIIFSQ KGRLYEFSST  60
SEVRKTIDRY RRSTND
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P3e-20160160Myocyte-specific enhancer factor 2B
1tqe_Q3e-20160160Myocyte-specific enhancer factor 2B
1tqe_R3e-20160160Myocyte-specific enhancer factor 2B
1tqe_S3e-20160160Myocyte-specific enhancer factor 2B
6c9l_A3e-20160160Myocyte-specific enhancer factor 2B
6c9l_B3e-20160160Myocyte-specific enhancer factor 2B
6c9l_C3e-20160160Myocyte-specific enhancer factor 2B
6c9l_D3e-20160160Myocyte-specific enhancer factor 2B
6c9l_E3e-20160160Myocyte-specific enhancer factor 2B
6c9l_F3e-20160160Myocyte-specific enhancer factor 2B
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtMADS-box transcription factor that acts with AGL71 and AGL72 in the control of flowering time. Promotes flowering at the shoot apical and axillary meristems. Seems to act through a gibberellin-dependent pathway. Interacts genetically with SOC1 and its expression is directly regulated by SOC1 (PubMed:21609362). Plays a role in controlling flower organ senescence and abscission by repressing ethylene responses and regulating the expression of BOP2 and IDA (PubMed:21689171). {ECO:0000269|PubMed:21609362, ECO:0000269|PubMed:21689171}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010035068.11e-47PREDICTED: MADS-box protein AGL42
SwissprotQ9FIS16e-36AGL42_ARATH; MADS-box protein AGL42
TrEMBLA0A058ZY023e-46A0A058ZY02_EUCGR; Uncharacterized protein
STRINGXP_010035068.15e-47(Eucalyptus grandis)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G62165.42e-38AGAMOUS-like 42