![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | EcC053697.70 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
|
||||||||
| Family | NF-YB | ||||||||
| Protein Properties | Length: 146aa MW: 15700.6 Da PI: 7.4139 | ||||||||
| Description | NF-YB family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NF-YB | 180 | 2.1e-56 | 27 | 121 | 1 | 95 |
NF-YB 1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyreleg 95
vreqdr+lPian+srimkk+lPan+ki+kdaketvqecvsefisf+tseasdkcqrekrktingddllwa+atlGfedy++plk+yl++yre ++
EcC053697.70 27 VREQDRYLPIANISRIMKKALPANGKIAKDAKETVQECVSEFISFITSEASDKCQREKRKTINGDDLLWAMATLGFEDYLDPLKIYLARYREGDT 121
69*****************************************************************************************9665 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.20.10 | 6.1E-53 | 25 | 128 | IPR009072 | Histone-fold |
| SuperFamily | SSF47113 | 1.18E-39 | 30 | 127 | IPR009072 | Histone-fold |
| Pfam | PF00808 | 2.3E-28 | 33 | 97 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
| PRINTS | PR00615 | 2.0E-20 | 61 | 79 | No hit | No description |
| PROSITE pattern | PS00685 | 0 | 64 | 80 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
| PRINTS | PR00615 | 2.0E-20 | 80 | 98 | No hit | No description |
| PRINTS | PR00615 | 2.0E-20 | 99 | 117 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0005975 | Biological Process | carbohydrate metabolic process | ||||
| GO:0006260 | Biological Process | DNA replication | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0006979 | Biological Process | response to oxidative stress | ||||
| GO:0055114 | Biological Process | oxidation-reduction process | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0004553 | Molecular Function | hydrolase activity, hydrolyzing O-glycosyl compounds | ||||
| GO:0004601 | Molecular Function | peroxidase activity | ||||
| GO:0004842 | Molecular Function | ubiquitin-protein transferase activity | ||||
| GO:0005524 | Molecular Function | ATP binding | ||||
| GO:0008270 | Molecular Function | zinc ion binding | ||||
| GO:0020037 | Molecular Function | heme binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| GO:0046982 | Molecular Function | protein heterodimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 146 aa Download sequence Send to blast |
MAEAPASPGG GGSHESGEHS PRSGGAVREQ DRYLPIANIS RIMKKALPAN GKIAKDAKET 60 VQECVSEFIS FITSEASDKC QREKRKTING DDLLWAMATL GFEDYLDPLK IYLARYREGD 120 TKGSAKVGEA STKRDGAAVQ SVPNAQ |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1n1j_A | 2e-48 | 26 | 118 | 1 | 93 | NF-YB |
| 4awl_B | 2e-48 | 26 | 118 | 2 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
| 4csr_A | 2e-48 | 26 | 118 | 2 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. | |||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_010046844.1 | 1e-101 | PREDICTED: nuclear transcription factor Y subunit B-1 | ||||
| Swissprot | Q8VYK4 | 9e-75 | NFYB8_ARATH; Nuclear transcription factor Y subunit B-8 | ||||
| TrEMBL | A0A059DEF2 | 1e-102 | A0A059DEF2_EUCGR; Uncharacterized protein | ||||
| STRING | XP_010046844.1 | 1e-101 | (Eucalyptus grandis) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G53340.1 | 3e-71 | nuclear factor Y, subunit B10 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




