PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

EcC054120.10

Organism

Eucalyptus camaldulensis

Taxonomic ID

34316

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus

Family

MYB_related

Protein Properties

Length: 75aa MW: 8963.54 Da PI: 10.4347

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
EcC054120.10	genome	ECGD	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	49.2	1.2e-15	8	53	2	48
SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 g W Ede+l+ av ++G+++W++I++ + ++++kqck rw+ +l EcC054120.10 8 GVWKNTEDEILKAAVMKYGKNQWARISSLLV-RKSAKQCKARWYEWL 53 78***************************.**********986 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51294	22.008	2	57	IPR017930	Myb domain
SuperFamily	SSF46689	5.79E-19	3	68	IPR009057	Homeodomain-like
SMART	SM00717	7.0E-15	6	55	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	2.1E-17	6	53	IPR009057	Homeodomain-like
Pfam	PF13921	2.2E-14	10	70	No hit	No description
CDD	cd00167	1.70E-10	10	53	No hit	No description
Gene3D	G3DSA:1.10.10.60	8.6E-6	54	74	IPR009057	Homeodomain-like
PROSITE profile	PS51294	7.413	58	75	IPR017930	Myb domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 75 aa Download sequence Send to blast
MRIMIKGGVW KNTEDEILKA AVMKYGKNQW ARISSLLVRK SAKQCKARWY EWLDPSIKKT 60 EWTREEDEKL LHLAK

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
5mqf_L	2e-42	2	75	3	76	Cell division cycle 5-like protein
5xjc_L	2e-42	2	75	3	76	Cell division cycle 5-like protein
5yzg_L	2e-42	2	75	3	76	Cell division cycle 5-like protein
5z56_L	2e-42	2	75	3	76	Cell division cycle 5-like protein
5z57_L	2e-42	2	75	3	76	Cell division cycle 5-like protein
5z58_L	2e-42	2	75	3	76	Cell division cycle 5-like protein
6ff4_L	2e-42	2	75	3	76	Cell division cycle 5-like protein
6ff7_L	2e-42	2	75	3	76	Cell division cycle 5-like protein
6icz_L	2e-42	2	75	3	76	Cell division cycle 5-like protein
6id0_L	2e-42	2	75	3	76	Cell division cycle 5-like protein
6id1_L	2e-42	2	75	3	76	Cell division cycle 5-like protein
6qdv_O	2e-42	2	75	3	76	Cell division cycle 5-like protein
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Component of the MAC complex that probably regulates defense responses through transcriptional control and thereby is essential for plant innate immunity. Possesses a sequence specific DNA sequence 'CTCAGCG' binding activity. Involved in mRNA splicing and cell cycle control. May also play a role in the response to DNA damage. {ECO:0000250\|UniProtKB:Q99459, ECO:0000269\|PubMed:17298883, ECO:0000269\|PubMed:17575050, ECO:0000269\|PubMed:8917598}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_003056512.1	1e-47	predicted protein, partial
Refseq	XP_016516169.1	6e-48	PREDICTED: cell division cycle 5-like protein, partial
Refseq	XP_019232628.1	2e-47	PREDICTED: cell division cycle 5-like protein
Swissprot	P92948	1e-46	CDC5L_ARATH; Cell division cycle 5-like protein
TrEMBL	A0A1R3HNX5	1e-46	A0A1R3HNX5_COCAP; Uncharacterized protein (Fragment)
TrEMBL	A0A392TLI1	1e-46	A0A392TLI1_9FABA; Cell division cycle 5-like protein (Fragment)
STRING	XP_003056512.1	6e-47	(Micromonas pusilla)
STRING	Lus10043451	2e-47	(Linum usitatissimum)
STRING	XP_009631530.1	4e-46	(Nicotiana tomentosiformis)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM16532	9	13

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G09770.1	4e-49	cell division cycle 5

Publications ? help Back to Top
Heyndrickx KS,Vandepoele K Systematic identification of functional plant modules through the integration of complementary data sources. Plant Physiol., 2012. 159(3): p. 884-901 [PMID:22589469] Li S, et al. MAC3A and MAC3B, Two Core Subunits of the MOS4-Associated Complex, Positively Influence miRNA Biogenesis. Plant Cell, 2018. 30(2): p. 481-494 [PMID:29437988]