PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EcC054286.20
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family ZF-HD
Protein Properties Length: 80aa    MW: 8713.92 Da    PI: 8.7946
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EcC054286.20genomeECGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer93.41.9e-292277359
   ZF-HD_dimer  3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrevee 59
                  ++rY eC kN+A s+GghavDGC+Efm+  geegtaaal CaACgCHR+FH+r v +
  EcC054286.20 22 TIRYGECEKNQAESIGGHAVDGCREFMAR-GEEGTAAALICAACGCHRSFHKRIVMT 77
                  79**************************8.999*******************98765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257747.0E-202278IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047701.1E-272373IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015662.8E-232473IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152324.9232574IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Sequence ? help Back to Top
Protein Sequence    Length: 80 aa     Download sequence    Send to blast
MKRVQVVVVK GSSASSRRRG ETIRYGECEK NQAESIGGHA VDGCREFMAR GEEGTAAALI  60
CAACGCHRSF HKRIVMTENQ
Functional Description ? help Back to Top
Source Description
UniProtInhibits zinc finger homeodomain (ZHD) transcription factors by interacting with them to prevent both their nuclear localization and their DNA-binding properties. Involved in integrating signals from multiple hormones by regulating the expression of specific genes. {ECO:0000269|PubMed:21455630}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_027187539.15e-28mini zinc finger protein 2-like
RefseqXP_027187540.15e-28mini zinc finger protein 2-like
SwissprotQ9LJW55e-26MIF2_ARATH; Mini zinc finger protein 2
TrEMBLA0A059AQD82e-49A0A059AQD8_EUCGR; Uncharacterized protein
STRINGXP_004489393.12e-27(Cicer arietinum)
STRINGXP_004489394.12e-27(Cicer arietinum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G28917.12e-28mini zinc finger 2
Publications ? help Back to Top
  1. Bollier N, et al.
    At-MINI ZINC FINGER2 and Sl-INHIBITOR OF MERISTEM ACTIVITY, a Conserved Missing Link in the Regulation of Floral Meristem Termination in Arabidopsis and Tomato.
    Plant Cell, 2018. 30(1): p. 83-100
    [PMID:29298836]