PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

EcC054802.310

Organism

Eucalyptus camaldulensis

Taxonomic ID

34316

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus

Family

MYB_related

Protein Properties

Length: 88aa MW: 10755.3 Da PI: 9.8025

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
EcC054802.310	genome	ECGD	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	25.5	3.1e-08	30	69	4	45
S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS Myb_DNA-binding 4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 ++++E++l+++ k+ G + W++Ia +++ gR ++++ +w EcC054802.310 30 MSEQEEDLIYRMYKLVGDR-WALIAGRIP-GRKAEEIERFWI 69 79*************99.*****.*******995 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00717	1.5E-5	26	74	IPR001005	SANT/Myb domain
CDD	cd00167	3.88E-5	29	68	No hit	No description
Pfam	PF00249	1.7E-7	30	69	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	5.4E-10	31	69	IPR009057	Homeodomain-like
SuperFamily	SSF46689	4.99E-7	31	69	IPR009057	Homeodomain-like

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0005975	Biological Process	carbohydrate metabolic process
GO:0006032	Biological Process	chitin catabolic process
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0006412	Biological Process	translation
GO:0006887	Biological Process	exocytosis
GO:0007020	Biological Process	microtubule nucleation
GO:0031122	Biological Process	cytoplasmic microtubule organization
GO:0048278	Biological Process	vesicle docking
GO:0000930	Cellular Component	gamma-tubulin complex
GO:0005840	Cellular Component	ribosome
GO:0032040	Cellular Component	small-subunit processome
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0003735	Molecular Function	structural constituent of ribosome
GO:0003924	Molecular Function	GTPase activity
GO:0004568	Molecular Function	chitinase activity
GO:0005515	Molecular Function	protein binding
GO:0016853	Molecular Function	isomerase activity
GO:0030246	Molecular Function	carbohydrate binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 88 aa Download sequence Send to blast
MDKQRRHKQA RTSSCCSDEV SSIEWEFINM SEQEEDLIYR MYKLVGDRWA LIAGRIPGRK 60 AEEIERFWIM RHGEVFAERR RQLRRHKS

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor. Involved in epidermal cell fate specification. Negative regulator of trichome development, including endoreplication, by lateral inhibition involving intercellular interactions. Promotes the formation of hair developing cells (trichoblasts) in H position in root epidermis, probably by inhibiting non-hair cell (atrichoblasts) formation. {ECO:0000269\|PubMed:10368181, ECO:0000269\|PubMed:12356720}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Negative autoregulation. Repressed by CPC. {ECO:0000269\|PubMed:12356720}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_010055038.1	5e-59	PREDICTED: transcription factor CPC isoform X2
Swissprot	Q8GV05	1e-37	TRY_ARATH; Transcription factor TRY
TrEMBL	A0A059BZI7	1e-57	A0A059BZI7_EUCGR; Uncharacterized protein
STRING	XP_010055037.1	2e-54	(Eucalyptus grandis)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G53200.1	6e-40	MYB_related family protein

Publications ? help Back to Top
Perazza D, et al. Trichome cell growth in Arabidopsis thaliana can be derepressed by mutations in at least five genes. Genetics, 1999. 152(1): p. 461-76 [PMID:10224275] Scheres B Plant patterning: TRY to inhibit your neighbors. Curr. Biol., 2002. 12(23): p. R804-6 [PMID:12477405] Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Brininstool G, et al. Constitutive Expressor Of Pathogenesis-related Genes5 affects cell wall biogenesis and trichome development. BMC Plant Biol., 2008. 8: p. 58 [PMID:18485217] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Xue XY, et al. Interaction between two timing microRNAs controls trichome distribution in Arabidopsis. PLoS Genet., 2014. 10(4): p. e1004266 [PMID:24699192] Nayidu NK, et al. Comparison of five major trichome regulatory genes in Brassica villosa with orthologues within the Brassicaceae. PLoS ONE, 2014. 9(4): p. e95877 [PMID:24755905] Taheri A, et al. A landscape of hairy and twisted: hunting for new trichome mutants in the Saskatoon Arabidopsis T-DNA population. Plant Biol (Stuttg), 2015. 17(2): p. 384-94 [PMID:25348773] Wada T,Hayashi N,Tominaga-Wada R Root hair formation at the root-hypocotyl junction in CPC-LIKE MYB double and triple mutants of Arabidopsis. Plant Signal Behav, 2015. 10(11): p. e1089372 [PMID:26339713] Wada T,Tominaga-Wada R CAPRICE family genes control flowering time through both promoting and repressing CONSTANS and FLOWERING LOCUS T expression. Plant Sci., 2015. 241: p. 260-5 [PMID:26706076] Tian H, et al. NTL8 Regulates Trichome Formation in Arabidopsis by Directly Activating R3 MYB Genes TRY and TCL1. Plant Physiol., 2017. 174(4): p. 2363-2375 [PMID:28649093] Tominaga-Wada R,Wada T Extended C termini of CPC-LIKE MYB proteins confer functional diversity in Arabidopsis epidermal cell differentiation. Development, 2017. 144(13): p. 2375-2380 [PMID:28676568] Kohanová J, et al. Root hair abundance impacts cadmium accumulation in Arabidopsis thaliana shoots. Ann. Bot., 2018. 122(5): p. 903-914 [PMID:29394308] Yamada K,Sasabe M,Fujikawa Y,Wada T,Tominaga-Wada R Amino acid substitutions in CPC-LIKE MYB reveal residues important for protein stability in Arabidopsis roots. PLoS ONE, 2018. 13(10): p. e0205522 [PMID:30308079] Kribii R, et al. Cloning and characterization of the Arabidopsis thaliana SQS1 gene encoding squalene synthase--involvement of the C-terminal region of the enzyme in the channeling of squalene through the sterol pathway. Eur. J. Biochem., 1997. 249(1): p. 61-9 [PMID:9363754]