![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | EcC054802.60 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
|
||||||||
| Family | WRKY | ||||||||
| Protein Properties | Length: 105aa MW: 12474.5 Da PI: 10.9206 | ||||||||
| Description | WRKY family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | WRKY | 104.7 | 5e-33 | 26 | 84 | 1 | 59 |
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59
ldDg++WrKYGqK vk+s +prsYYrCt+++C+vkk+v+r a+d+++v++tYeg Hnh+
EcC054802.60 26 LDDGFRWRKYGQKAVKNSVHPRSYYRCTHHTCNVKKQVQRLAKDTSIVVTTYEGIHNHP 84
59********************************************************8 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:2.20.25.80 | 1.1E-33 | 12 | 84 | IPR003657 | WRKY domain |
| SuperFamily | SSF118290 | 6.54E-29 | 20 | 85 | IPR003657 | WRKY domain |
| PROSITE profile | PS50811 | 27.737 | 21 | 86 | IPR003657 | WRKY domain |
| SMART | SM00774 | 1.5E-37 | 26 | 85 | IPR003657 | WRKY domain |
| Pfam | PF03106 | 2.6E-26 | 27 | 84 | IPR003657 | WRKY domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0005975 | Biological Process | carbohydrate metabolic process | ||||
| GO:0006032 | Biological Process | chitin catabolic process | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0006412 | Biological Process | translation | ||||
| GO:0006887 | Biological Process | exocytosis | ||||
| GO:0007020 | Biological Process | microtubule nucleation | ||||
| GO:0031122 | Biological Process | cytoplasmic microtubule organization | ||||
| GO:0048278 | Biological Process | vesicle docking | ||||
| GO:0000930 | Cellular Component | gamma-tubulin complex | ||||
| GO:0005840 | Cellular Component | ribosome | ||||
| GO:0032040 | Cellular Component | small-subunit processome | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0003735 | Molecular Function | structural constituent of ribosome | ||||
| GO:0003924 | Molecular Function | GTPase activity | ||||
| GO:0004568 | Molecular Function | chitinase activity | ||||
| GO:0005515 | Molecular Function | protein binding | ||||
| GO:0016853 | Molecular Function | isomerase activity | ||||
| GO:0030246 | Molecular Function | carbohydrate binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 105 aa Download sequence Send to blast |
KKVTNRTRKP TRPRIAFQTR SVDDILDDGF RWRKYGQKAV KNSVHPRSYY RCTHHTCNVK 60 KQVQRLAKDT SIVVTTYEGI HNHPCEKLME TLTPLLKQMQ FLSRF |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1wj2_A | 3e-25 | 16 | 83 | 7 | 74 | Probable WRKY transcription factor 4 |
| 2ayd_A | 4e-25 | 14 | 83 | 2 | 71 | WRKY transcription factor 1 |
| 2lex_A | 3e-25 | 16 | 83 | 7 | 74 | Probable WRKY transcription factor 4 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}. | |||||
| UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}. | |||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_010055075.1 | 4e-75 | PREDICTED: probable WRKY transcription factor 24 | ||||
| Swissprot | Q8VWQ4 | 5e-56 | WRK56_ARATH; Probable WRKY transcription factor 56 | ||||
| Swissprot | Q9FFS3 | 4e-56 | WRK24_ARATH; Probable WRKY transcription factor 24 | ||||
| TrEMBL | A0A059C012 | 9e-74 | A0A059C012_EUCGR; Uncharacterized protein | ||||
| STRING | XP_010055075.1 | 1e-74 | (Eucalyptus grandis) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G41570.1 | 2e-58 | WRKY DNA-binding protein 24 | ||||




