![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | EcC054892.20 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
|
||||||||
| Family | NAC | ||||||||
| Protein Properties | Length: 193aa MW: 22012.1 Da PI: 4.6926 | ||||||||
| Description | NAC family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NAM | 105.2 | 8.4e-33 | 7 | 80 | 54 | 128 |
NAM 54 eekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
++ ewyfF +rd+ky++g r+nrat++gyWk+tgkd++v+s +++ +g+kktLv+y+grap+g++tdWvmheyrl
EcC054892.20 7 RDPEWYFFGPRDRKYPNGFRTNRATRAGYWKSTGKDRKVTS-QNRPIGMKKTLVYYRGRAPQGVRTDWVMHEYRL 80
5679*************************************.999****************************98 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS51005 | 40.518 | 1 | 103 | IPR003441 | NAC domain |
| SuperFamily | SSF101941 | 5.49E-40 | 6 | 104 | IPR003441 | NAC domain |
| Pfam | PF02365 | 7.3E-17 | 8 | 80 | IPR003441 | NAC domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0009828 | Biological Process | plant-type cell wall loosening | ||||
| GO:0010091 | Biological Process | trichome branching | ||||
| GO:0035556 | Biological Process | intracellular signal transduction | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0000166 | Molecular Function | nucleotide binding | ||||
| GO:0000976 | Molecular Function | transcription regulatory region sequence-specific DNA binding | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0008289 | Molecular Function | lipid binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 193 aa Download sequence Send to blast |
KSFLPSRDPE WYFFGPRDRK YPNGFRTNRA TRAGYWKSTG KDRKVTSQNR PIGMKKTLVY 60 YRGRAPQGVR TDWVMHEYRL DDKESEDTSG MQDSYALCRV FKKNGFGNEV EDQGQWSLSL 120 MESSQGVVMS QEWENNSPDV PIASSSCLDQ EDDKDDSWMQ FITDDGGWGT SNPNAPPIGG 180 DFGEEVSTLN FSN |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1ut4_A | 3e-33 | 10 | 104 | 72 | 166 | NO APICAL MERISTEM PROTEIN |
| 1ut4_B | 3e-33 | 10 | 104 | 72 | 166 | NO APICAL MERISTEM PROTEIN |
| 1ut7_A | 3e-33 | 10 | 104 | 72 | 166 | NO APICAL MERISTEM PROTEIN |
| 1ut7_B | 3e-33 | 10 | 104 | 72 | 166 | NO APICAL MERISTEM PROTEIN |
| 3swm_A | 4e-33 | 10 | 104 | 75 | 169 | NAC domain-containing protein 19 |
| 3swm_B | 4e-33 | 10 | 104 | 75 | 169 | NAC domain-containing protein 19 |
| 3swm_C | 4e-33 | 10 | 104 | 75 | 169 | NAC domain-containing protein 19 |
| 3swm_D | 4e-33 | 10 | 104 | 75 | 169 | NAC domain-containing protein 19 |
| 3swp_A | 4e-33 | 10 | 104 | 75 | 169 | NAC domain-containing protein 19 |
| 3swp_B | 4e-33 | 10 | 104 | 75 | 169 | NAC domain-containing protein 19 |
| 3swp_C | 4e-33 | 10 | 104 | 75 | 169 | NAC domain-containing protein 19 |
| 3swp_D | 4e-33 | 10 | 104 | 75 | 169 | NAC domain-containing protein 19 |
| 4dul_A | 3e-33 | 10 | 104 | 72 | 166 | NAC domain-containing protein 19 |
| 4dul_B | 3e-33 | 10 | 104 | 72 | 166 | NAC domain-containing protein 19 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor directing sieve element enucleation and cytosol degradation. Not required for formation of lytic vacuoles. Regulates, with NAC086, the transcription of NEN1, NEN2, NEN3, NEN4, RTM1, RTM2, UBP16, PLDZETA, ABCB10 and At1g26450. {ECO:0000269|PubMed:25081480}. | |||||
| Binding Motif ? help Back to Top | |||
|---|---|---|---|
| Motif ID | Method | Source | Motif file |
| MP00232 | DAP | Transfer from AT1G73360 | Download |
| |||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Regulated by the transcription factor APL (AC Q9SAK5). {ECO:0000269|PubMed:25081480}. | |||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_010069496.1 | 1e-141 | PREDICTED: NAC domain-containing protein 86 | ||||
| Swissprot | A4VCM0 | 3e-51 | NAC45_ARATH; NAC domain-containing protein 45 | ||||
| TrEMBL | A0A059AW31 | 1e-140 | A0A059AW31_EUCGR; Uncharacterized protein | ||||
| STRING | XP_010069496.1 | 1e-141 | (Eucalyptus grandis) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G17730.1 | 1e-82 | NAC domain containing protein 57 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




