![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | EcC054947.80 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
|
||||||||
| Family | M-type_MADS | ||||||||
| Protein Properties | Length: 60aa MW: 6660.81 Da PI: 11.0659 | ||||||||
| Description | M-type_MADS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SRF-TF | 92.3 | 2.4e-29 | 10 | 59 | 2 | 51 |
---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
SRF-TF 2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
ri+n++ rqvtfskRrng+lKKA+EL +LCdaev viifsstgkly+++s
EcC054947.80 10 RIDNSTSRQVTFSKRRNGLLKKAKELAILCDAEVGVIIFSSTGKLYDFAS 59
8***********************************************86 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50066 | 31.651 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
| SMART | SM00432 | 3.7E-40 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
| SuperFamily | SSF55455 | 2.35E-28 | 2 | 59 | IPR002100 | Transcription factor, MADS-box |
| CDD | cd00265 | 2.34E-37 | 2 | 60 | No hit | No description |
| PRINTS | PR00404 | 2.3E-29 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
| PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF00319 | 5.6E-27 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 2.3E-29 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 2.3E-29 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0055085 | Biological Process | transmembrane transport | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0008270 | Molecular Function | zinc ion binding | ||||
| GO:0046983 | Molecular Function | protein dimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 60 aa Download sequence Send to blast |
MGRGKIVIRR IDNSTSRQVT FSKRRNGLLK KAKELAILCD AEVGVIIFSS TGKLYDFAST |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5f28_A | 5e-20 | 1 | 60 | 1 | 60 | MEF2C |
| 5f28_B | 5e-20 | 1 | 60 | 1 | 60 | MEF2C |
| 5f28_C | 5e-20 | 1 | 60 | 1 | 60 | MEF2C |
| 5f28_D | 5e-20 | 1 | 60 | 1 | 60 | MEF2C |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription factor involved in the regulation of flowering time in long-day photoperiod. Participates in the repression of FT expression and floral transition, by interacting closely with the FLC-SVP pathways (PubMed:24876250). Functions in the satellite meristemoid lineage of stomatal development (PubMed:17704216). {ECO:0000269|PubMed:17704216, ECO:0000269|PubMed:24876250}. | |||||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Repressed by the micro RNA miR824. {ECO:0000269|PubMed:18579782}. | |||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_004490465.1 | 3e-35 | MADS-box transcription factor 23-like isoform X2 | ||||
| Refseq | XP_004490466.1 | 2e-35 | MADS-box transcription factor 23-like isoform X3 | ||||
| Refseq | XP_012568392.1 | 2e-35 | MADS-box transcription factor 23-like isoform X3 | ||||
| Refseq | XP_021283893.1 | 6e-36 | MADS-box transcription factor 27-like | ||||
| Refseq | XP_026433223.1 | 6e-36 | MADS-box transcription factor 27-like isoform X6 | ||||
| Swissprot | A2RVQ5 | 2e-31 | AGL16_ARATH; Agamous-like MADS-box protein AGL16 | ||||
| TrEMBL | A0A498JET2 | 2e-34 | A0A498JET2_MALDO; Uncharacterized protein | ||||
| TrEMBL | W9RX21 | 3e-34 | W9RX21_9ROSA; MADS-box transcription factor 27 | ||||
| STRING | XP_010104581.1 | 5e-35 | (Morus notabilis) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G57230.1 | 8e-34 | AGAMOUS-like 16 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




