![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | EcC055228.40 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
|
||||||||
| Family | MYB | ||||||||
| Protein Properties | Length: 129aa MW: 14892.4 Da PI: 10.5714 | ||||||||
| Description | MYB family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 23.5 | 1.3e-07 | 4 | 30 | 21 | 48 |
TT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
Myb_DNA-binding 21 ggtWktIartmgkgRtlkqcksrwqkyl 48
gg W+++ + g++R++k+c++rw++yl
EcC055228.40 4 GG-WSKVCKATGLKRCGKSCRLRWLNYL 30
56.*********9**************7 PP
| |||||||
| 2 | Myb_DNA-binding | 52.7 | 9.7e-17 | 36 | 79 | 1 | 46 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
rg+ ++eE+el+++++++lG++ W +Ia +++ gRt++++k++w++
EcC055228.40 36 RGNISPEEEELIIRLHRLLGNR-WVLIAGRLP-GRTDNEIKNYWNS 79
7999******************.*********.***********97 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS51294 | 8.501 | 1 | 30 | IPR017930 | Myb domain |
| Gene3D | G3DSA:1.10.10.60 | 3.6E-10 | 3 | 33 | IPR009057 | Homeodomain-like |
| Pfam | PF00249 | 4.5E-6 | 4 | 30 | IPR001005 | SANT/Myb domain |
| SuperFamily | SSF46689 | 2.09E-21 | 16 | 91 | IPR009057 | Homeodomain-like |
| PROSITE profile | PS51294 | 25.804 | 31 | 85 | IPR017930 | Myb domain |
| Gene3D | G3DSA:1.10.10.60 | 1.4E-25 | 34 | 85 | IPR009057 | Homeodomain-like |
| SMART | SM00717 | 6.4E-16 | 35 | 83 | IPR001005 | SANT/Myb domain |
| Pfam | PF00249 | 6.7E-15 | 36 | 79 | IPR001005 | SANT/Myb domain |
| CDD | cd00167 | 1.18E-10 | 40 | 78 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0015074 | Biological Process | DNA integration | ||||
| GO:0016021 | Cellular Component | integral component of membrane | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0005515 | Molecular Function | protein binding | ||||
| GO:0008270 | Molecular Function | zinc ion binding | ||||
| GO:0016757 | Molecular Function | transferase activity, transferring glycosyl groups | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 129 aa Download sequence Send to blast |
MVKGGWSKVC KATGLKRCGK SCRLRWLNYL RPDIKRGNIS PEEEELIIRL HRLLGNRWVL 60 IAGRLPGRTD NEIKNYWNST IKKKLAQDNN DPPMNSKCED DKLTIPKYSA LLPPTNKNLH 120 KPTKAKEEK |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1a5j_A | 1e-22 | 17 | 85 | 40 | 108 | B-MYB |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription activator. Involved in the regulation of secondary wall biosynthesis in fibers and vessels (PubMed:17890373). Transcription activator of the mannan synthase CSLA9 that recognizes and binds to the DNA consensus sequence 5'-[AG][GT]T[AT]GGT[GA]-3' cis-regulatory element of CSLA9 promoter (PubMed:24243147). Transcription factor that acts as molecular switch in the NAC012/SND1-mediated transcriptional network regulating secondary wall biosynthesis. Is directly activated by NAC012/SND1. Functions redundantly with MYB83 in the transcriptional regulatory cascade leading to secondary wall formation in fibers and vessels (PubMed:19808805). Transcription activator that binds to the DNA consensus sequence 5'-ACC[AT]A[AC][TC]-3', designated as the secondary wall MYB-responsive element (SMRE). Regulates directly numerous transcription factors and a number of genes involved in secondary wall biosynthesis that contain SMRE elements in their promoters (PubMed:22197883). Is an obligate component of the transcriptional regulatory complex toward the commitment of secondary wall cellulose synthesis. Is required for functional expression of the three secondary wall CESA genes, CESA4, CESA7 and CESA8 (PubMed:23726771). {ECO:0000269|PubMed:17890373, ECO:0000269|PubMed:19808805, ECO:0000269|PubMed:22197883, ECO:0000269|PubMed:23726771, ECO:0000269|PubMed:24243147}. | |||||
| UniProt | Transcription factor. {ECO:0000305}. | |||||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Slightly induced by salicylic acid (SA). Positively regulated by SND1 and homolog proteins. {ECO:0000269|PubMed:16463103, ECO:0000269|PubMed:17890373}. | |||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_010051341.1 | 1e-66 | PREDICTED: trichome differentiation protein GL1-like | ||||
| Swissprot | P81393 | 8e-41 | MYB08_ANTMA; Myb-related protein 308 | ||||
| Swissprot | Q9LXV2 | 8e-41 | MYB46_ARATH; Transcription factor MYB46 | ||||
| TrEMBL | A0A059CUD0 | 2e-56 | A0A059CUD0_EUCGR; Uncharacterized protein | ||||
| STRING | XP_010051341.1 | 4e-66 | (Eucalyptus grandis) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G12870.1 | 4e-34 | myb domain protein 46 | ||||




