![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | EcC057266.10 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
|
||||||||
| Family | LBD | ||||||||
| Protein Properties | Length: 46aa MW: 5087.87 Da PI: 8.2104 | ||||||||
| Description | LBD family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | DUF260 | 60.9 | 3.3e-19 | 7 | 46 | 1 | 40 |
DUF260 1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGas 40
+CaaCk +rrkC+++Cv+apyfpa+qp+kfa+vh++FGas
EcC057266.10 7 PCAACKCQRRKCTPECVFAPYFPADQPQKFAYVHEVFGAS 46
7*************************************86 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50891 | 16.313 | 6 | 46 | IPR004883 | Lateral organ boundaries, LOB |
| Pfam | PF03195 | 1.2E-17 | 7 | 46 | IPR004883 | Lateral organ boundaries, LOB |
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 46 aa Download sequence Send to blast |
MSSLSSPCAA CKCQRRKCTP ECVFAPYFPA DQPQKFAYVH EVFGAS |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5ly0_A | 4e-16 | 5 | 46 | 9 | 50 | LOB family transfactor Ramosa2.1 |
| 5ly0_B | 4e-16 | 5 | 46 | 9 | 50 | LOB family transfactor Ramosa2.1 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Controls the proximal-distal patterning in petals and the adaxial-abaxial determination of leaves. Involved in the repression of the homeobox gene BP. {ECO:0000269|PubMed:12787254, ECO:0000269|PubMed:15821980}. | |||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_010026421.1 | 3e-26 | PREDICTED: protein LATERAL ORGAN BOUNDARIES-like | ||||
| Swissprot | Q9FKZ3 | 1e-19 | LBD36_ARATH; LOB domain-containing protein 36 | ||||
| TrEMBL | A0A484N5R7 | 3e-19 | A0A484N5R7_9ASTE; Uncharacterized protein (Fragment) | ||||
| STRING | XP_010026421.1 | 1e-25 | (Eucalyptus grandis) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G66870.1 | 4e-22 | ASYMMETRIC LEAVES 2-like 1 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




