![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | EcC074612.10 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
|
||||||||
| Family | NAC | ||||||||
| Protein Properties | Length: 64aa MW: 7456.61 Da PI: 4.3456 | ||||||||
| Description | NAC family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NAM | 60.7 | 4.8e-19 | 8 | 64 | 1 | 58 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekew 58
lp+GfrFhPtdeelv++yL +k+++ ++++ +i+e+d+yk++PwdLp+++ +ekew
EcC074612.10 8 LPAGFRFHPTDEELVSDYLIRKCSSLPISA-PIIAEIDLYKFDPWDLPEMALYGEKEW 64
799*************************99.88***************6555567776 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SuperFamily | SSF101941 | 9.29E-22 | 4 | 64 | IPR003441 | NAC domain |
| PROSITE profile | PS51005 | 22.783 | 8 | 64 | IPR003441 | NAC domain |
| Pfam | PF02365 | 1.8E-7 | 9 | 49 | IPR003441 | NAC domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 64 aa Download sequence Send to blast |
MKKAQLELPA GFRFHPTDEE LVSDYLIRKC SSLPISAPII AEIDLYKFDP WDLPEMALYG 60 EKEW |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 3ulx_A | 1e-24 | 4 | 64 | 11 | 71 | Stress-induced transcription factor NAC1 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | May be involved in regulation of seed germination under flooding. {ECO:0000269|PubMed:19176720}. | |||||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: By low-oxygen stress. {ECO:0000269|PubMed:19176720}. | |||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_010027541.1 | 2e-39 | PREDICTED: NAC domain-containing protein 2 isoform X2 | ||||
| Swissprot | Q8H115 | 3e-30 | NA102_ARATH; NAC domain-containing protein 102 | ||||
| TrEMBL | A0A059AJ85 | 6e-38 | A0A059AJ85_EUCGR; Uncharacterized protein | ||||
| STRING | XP_010027536.1 | 1e-37 | (Eucalyptus grandis) | ||||
| STRING | XP_010027561.1 | 1e-37 | (Eucalyptus grandis) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM7967 | 13 | 40 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G63790.1 | 1e-32 | NAC domain containing protein 102 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




