PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

EcC074785.10

Organism

Eucalyptus camaldulensis

Taxonomic ID

34316

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus

Family

bZIP

Protein Properties

Length: 94aa MW: 10913.5 Da PI: 11.3288

Description

bZIP family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
EcC074785.10	genome	ECGD	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	bZIP_1	52.9	8.1e-17	34	80	5	51
CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkelee 51 +r++r++kNRe+A rsR+RK+a++ eLe+kv Le+eN++L+k+ + EcC074785.10 34 RRQKRMIKNRESAARSRARKQAYTSELENKVSRLEEENERLRKRKVN 80 79****************************************98655 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.20.5.170	8.5E-17	27	81	No hit	No description
SMART	SM00338	1.5E-12	30	94	IPR004827	Basic-leucine zipper domain
PROSITE profile	PS50217	11.679	32	82	IPR004827	Basic-leucine zipper domain
Pfam	PF00170	5.5E-15	34	81	IPR004827	Basic-leucine zipper domain
CDD	cd14707	3.04E-17	34	81	No hit	No description
SuperFamily	SSF57959	1.38E-12	34	78	No hit	No description
PROSITE pattern	PS00036	0	37	52	IPR004827	Basic-leucine zipper domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 94 aa Download sequence Send to blast
LALPSPLMGT LSDSQTSGRK RGIHEEVVDR SVERRQKRMI KNRESAARSR ARKQAYTSEL 60 ENKVSRLEEE NERLRKRKVN LSFKDSILIF VSLT

Functional Description ? help Back to Top
Source	Description
UniProt	Binds to the embryo specification element and the ABA-responsive element (ABRE) of the Dc3 gene promoter. Could participate in abscisic acid-regulated gene expression during seed development.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_010031349.1	7e-46	PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 2
Refseq	XP_010031350.1	7e-46	PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 2
Swissprot	Q9LES3	6e-31	AI5L2_ARATH; ABSCISIC ACID-INSENSITIVE 5-like protein 2
TrEMBL	A0A059A9T9	2e-44	A0A059A9T9_EUCGR; Uncharacterized protein
STRING	XP_010031349.1	3e-45	(Eucalyptus grandis)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM1884	28	83

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G56850.1	7e-25	ABA-responsive element binding protein 3

Publications ? help Back to Top
Kim H, et al. ABA-HYPERSENSITIVE BTB/POZ PROTEIN 1 functions as a negative regulator in ABA-mediated inhibition of germination in Arabidopsis. Plant Mol. Biol., 2016. 90(3): p. 303-15 [PMID:26667153] Song C,Kim T,Chung WS,Lim CO The Arabidopsis Phytocystatin AtCYS5 Enhances Seed Germination and Seedling Growth under Heat Stress Conditions. Mol. Cells, 2017. 40(8): p. 577-586 [PMID:28756655]