PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

EcS505225.10

Organism

Eucalyptus camaldulensis

Taxonomic ID

34316

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus

Family

HB-other

Protein Properties

Length: 54aa MW: 6357.48 Da PI: 10.6108

Description

HB-other family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
EcS505225.10	genome	ECGD	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Homeobox	54.6	1.8e-17	1	39	18	56
HHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS Homeobox 18 lFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 lF+++++p+ ++r +L+++lgL+ rqVk+WFqNrR+++k EcS505225.10 1 LFKECPHPDDKQRMRLSQELGLKPRQVKFWFQNRRTQMK 39 6***********************************998 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Pfam	PF00046	6.0E-15	1	39	IPR001356	Homeobox domain
SMART	SM00389	4.0E-4	1	45	IPR001356	Homeobox domain
PROSITE profile	PS50071	14.349	1	41	IPR001356	Homeobox domain
Gene3D	G3DSA:1.10.10.60	9.9E-16	2	40	IPR009057	Homeodomain-like
CDD	cd00086	4.19E-13	2	39	No hit	No description
SuperFamily	SSF46689	1.8E-14	2	39	IPR009057	Homeodomain-like
PRINTS	PR00031	2.0E-5	12	21	IPR000047	Helix-turn-helix motif
PROSITE pattern	PS00027	0	16	39	IPR017970	Homeobox, conserved site
PRINTS	PR00031	2.0E-5	21	37	IPR000047	Helix-turn-helix motif

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 54 aa Download sequence Send to blast
LFKECPHPDD KQRMRLSQEL GLKPRQVKFW FQNRRTQMKV CARVSVCVCG SFSG

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor. {ECO:0000250}.
UniProt	Probable transcription factor. {ECO:0000250}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_006432745.2	1e-21	homeobox-leucine zipper protein HDG5
Refseq	XP_006471522.1	1e-21	homeobox-leucine zipper protein HDG5 isoform X1
Refseq	XP_010053633.1	1e-21	PREDICTED: homeobox-leucine zipper protein HDG5
Refseq	XP_018727880.1	1e-21	PREDICTED: homeobox-leucine zipper protein HDG5
Refseq	XP_024952893.1	1e-21	homeobox-leucine zipper protein HDG5 isoform X2
Swissprot	A2ZAI7	5e-22	ROC3_ORYSI; Homeobox-leucine zipper protein ROC3
Swissprot	Q336P2	5e-22	ROC3_ORYSJ; Homeobox-leucine zipper protein ROC3
TrEMBL	A0A0K9Q2G0	2e-20	A0A0K9Q2G0_ZOSMR; Homeobox-leucine zipper protein ROC3
TrEMBL	A0A200PXG3	2e-20	A0A200PXG3_9MAGN; Homeobox domain
STRING	XP_006471522.1	5e-21	(Citrus sinensis)
STRING	XP_010053633.1	4e-21	(Eucalyptus grandis)
STRING	XP_006432745.1	5e-21	(Citrus clementina)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM17003	6	11

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G46880.1	1e-21	homeobox-7

Publications ? help Back to Top
Rice Chromosome 10 Sequencing Consortium In-depth view of structure, activity, and evolution of rice chromosome 10. Science, 2003. 300(5625): p. 1566-9 [PMID:12791992] Chou IT,Gasser CS Characterization of the cyclophilin gene family of Arabidopsis thaliana and phylogenetic analysis of known cyclophilin proteins. Plant Mol. Biol., 1997. 35(6): p. 873-92 [PMID:9426607]